Petition Writ of Mandamus

Cal. Super. - 6th Dist.September 20, 2021

APP _1 51 Petition for Writ (Misdemeanor, am stampsmhmmum asm Infraction, or Limited Civil Case) F I L E Christine Placencia mmmWommumm SEP 20 2021 V. Superior court ot camomh. county ot SANTA CLARA Hon. Carol Overton auxmm in mo number below. Rawandlm Appelde Division Cue Nam. mmmmomncounwnosauonormywmmng) 21Ap002749 MOHAMMAD MUSTAFA Reuputyin Imam: I Say requestedmannmofonyoMpamsmmuidcomcm) ‘ , (see Hem® c. on page 6) IMWCfiOflS ' This form is only for requesting a writ in a misdemeanor, infiaction, or limited civil me, or a writ challenging a posq'udgmem enforcement order in a snail claims case (sec bclow‘). - Do no! use this form for other writs and for appeals. You can get forms to use for those a any counhousc or county law library or online at www.amrrs.ca.gav{foms. - Befoxe you fill out this fonn. read Information on Writ Proceedings in Misdemeanor. lnfi’action. am Limited Civil Cases (form APP-lSO-INFO) to know your rights and rcsponsibilitics. You can get form APP-l 50-INFO at any courthouse or county law library or online 31 www.courts.ca goul‘farms. o Unless a special statute sets an carIicr deadline. you should file this form no laterthan 30 days aficr lhc dale the trial com! took me actioa or issued the ruling you am challenging in this petition (soc form APP-lSO-INFO, page 7. for more informmion about the dadline for filing a writ petition). It is your responsibility to find out ifa special swine sets an wriicr deadline. If your petition is filed late. the appellate division may deny it. - Fill out this form and make a copy of thc completed form for your records and for the respondent (the tn'al com! whose action or mling you axe challenging) and each of the real panics in intcmst (the other party or parties in the tn'al court msc). o Serve a copy ofthc completed form on the respondent and on each teal pany in interest and keep proofofthis service ProofofSerw'ce (Apmllale Division) (form APP-IU9) or l’mq/‘ofls'leclronic Service (Appellate Divm‘on) (form APP-109E) mu be used to make this record. You can get infoman'on about how to serve 001m papers and proofof service from What Is Proqu/‘Service? (form APP-lO9-INFO) and on the California Courts Online Sclf-Help Center at www.courts.cagov/selfhelp-servingfitm. - Take or mail the completed form and your proofof service on the respondent and each teal pany in intcma to me clerk's oflicc for thc appellate division of the superior court that took the action or issued the ruling you am challenging. ‘ Small Claims cam. lfyou are a party 1n a small claims case, this form is only to be used for requesting a writ relating to a postjudgmem enforcement order of a small claims division. For writs relating to other acts ofa small claims division, the form to use is the Petitionjbr Writ (Small Claims) (fonn 80300). Sec also Cal. Rules of Court, mles 8970-8977. For writs relating to acts ofa superior court in a small claims appeal. see Cal. Rules of Court, rules 8.485- 8.493. WWdC-flann. coat - - . -wmxmummy” “W Penna" for wnt APP 151, Page 1 017mm¢mmama (Mum. «macaw, or Lamina Civil ease) -9 mm Div'nbn Wm Division CueMum c...um: Placencia v Superior Court 2 1 A P 0 o 7 4 9 ® Your Informafion a Petitioner (the party who is asking for thc wn't): Name: Christine Placencia Sm“ addmss; 3277 S White Rd #272 San Jose CA 95 148 amt City mu 3p Mailing addmcs (ifdiflerem): woo! aty ado Zp Phone: E-mail: b. Petitioner‘s lawyer (skip (his iflhe petitioner does not have a lawyerfirr this petition): Name: None'Pm Per State Bar number. Sheet addmss: smut dry sm- Zp Mailing address (ifdifiErem): Giy State 3p Phone: E-mail: Fax: The Trid Court Acfion ot Ruling You Are Challenging ® I an/My chem is filing dais petition to challenge an action taken or mung made by me ma! com: in me following Q56: a Case name (fill in the trial court case name): Mustafa V Placenda b. Case number (fill in the m'al court case number): ® The tn'al coun action or ruling lam/my client is challenging is (describe the action mken 0r mling made by the In‘aI court).- The trial court erroneously denied a motion f0 mew trial where Defendant did not have noticeofthe-ni'aane olr' - ‘r - .‘J'H. .c u-nvv -n"on. . '- i ® Thc trial coun took this action or made this ruling on the following dale (fill in the date): 09/16/21 <9 Ifyou arefiling (his petition more than 30 days afler the dale that you listed in®. explain the extraordimry circumstances that caused (he delay inflling this petition: Wm‘l. 817 Pefifion for Wfit ”-151. Paw 2 d7(MW. Infraction, or Limihd Civil Case) -9 WW W cueum; Placencia v Supcn'or Court ”m The Parties in the Trial Court Case IIMy chem (check andfiu m a or b).- a.' wasapartyinthewseidentifiediné). b. U was not a party in the case identified in® but will be directly awmvdyam in the following way by the action taken or ruling made by the tn'al court (describe how you/wur alien: will be wnctly and negatively aflected by the (rial court 's action or ruling): ® The other party or patties in the casc identified in® waslwerc (fill in the names ofthe parties):MOHAMMAD M! ISTAFA Appeals or Other Peh'tions for Writs in This Case Did you or anyone else file an appal about the same trial ooun adieu or ruling you am challenging in this petition? (Check ardfill in a 0r h): a/No b. Yes (fill in the appellate division case member ofthe appeal): Have you filed a previous petition for a wn't challenging this uial court action or ruling? (Check arufill in a or b): a. I No b, Yes (Please provide (hefollowing information about this previous petition). (l) Petition title (fill in the title oflhe petition): (2) Date petition filed (fill m (he date yuufiled this petition): (3) Case number (fill in the case number ofrhe petition): Ifyou/your clienlfiled more than one previous petition. attach anothermge providing this iriurman‘onfilr each additional petition. At the lop ofeach page. write "APP-ISI. item 9. ") Reasons for This Pefition 11m man court made me following legal em: or cums when it took me action or made me mung described in@ (check andfill in at least one): a. The m'al court has not done or has mfixscd to do something that the law says it mus! do. (l) Descnbe why! yvu believe thg law says the m‘a! court myst d0: The trial COUl'l iS required t0 vacate the Judgment as v01d when the Defendant dld not e an e co s o c1 c ' 'Gr the scheduied m'ai dam. (2) Idemtfl the law (the section ofthe Constitution or statute. published court decision or other legal authority) that says the m'al court mus! do this: C.C.P. §1085, C.C.P. §1086, C.C.P. §594, illmm 958. 966 [Adverse party entitled to notice of trial. Because plaintifi failed to do so here, the tn'al court erred in holding the tn'al] WM1. m7 pwfion for writ APP-151. Page 3 on (Misdemeanor. Macaw, or Limited Civil ease) -9 W Divisbn Appell‘e DIViSbn Cale N "bet: c...Mm; Placencia v Superior Court 2 1 P 0 § (continued) (3) Idemfiv where m the supporting documents (the record ofwhat was said in (he trial court and the documentsfrom the (rial court) it shows (ha! the coun did no! do or refined to do this: Order 09/16/202 l , Order 09/ l 3/2021 U Check here ifwu need more space lo describe the reasonforyourpetition and attach a separate page or pages desgribing it. AI the lop ofeach page, write "APP-l5l. item [0a " um menialoounhasdonc somcmmgmmmem-mysmecouncmmommrmrdo. (l) Describe whal the (rial court did: (2) Idemfl where in (he supporting documents (the record a_fwhar was said in the (rial court and the documentsfmm the ma! court) it shows that the court did this: (3) ldemfl the law (the section ofthe Constitution or statute, published court decision. or other legal authority) that says the trial court cannot or must notw this: U Check here ifyou need more space lo descnbe the reasonfbryour petition and attach a separate page orpages describing it. A! the top ofeach page. write "AI’P-l51. item [0b. " c.D The trial court has performed or said it is going to perform ajudicial function (like deciding a person’s rights under law in a particular situation) in a way the court does not have the legal power to do. (l) Describe what the m‘al court did or said it is going Io do: (2) [dermfv where in the supporting documents (the record wahal was said in the trial court and the documentsfrom the trial court) i! shows that the court did or said i! was going ta do this: wWY ‘. N17 Petifion for Writ ”9-151, Paw 4d 7 (Misdaneanor.mum. or Linneacm ease) -) . Placencia v Superior Court 2 logkfionocfi a a 9 (continued) (3) Idermfi the law (the section ofthe Constitun‘an ar statute. published court decision or olher legal authority) (Int S&ys the trial courl does not lave (he power m do (his: D Clwck here ifyou need more space (a describe this reasonforyourpetition am! attach a semrme page or page: describing it. At the tap qfeach mge. write “APP-l5l. item 10¢. " D Check here {fthere are more reasonsjbr this petition and attach an additional page or pages describing these wasons. At (he lop ofeach page. write "APP-l5l. item 10d. " ® nus petition wiu be granted only «mere is no odmadequaze my Lo address me man court‘s action or mung other than by issuing the requested wn't. a. Explain why there is no way other rinn through this pelilionfbr a writ- through an appeal. ‘br example»---fin‘ your arguments to be adequately presented to lhe apmllate dtvmon: l. .t b. Explain how yuufiwur client will be irreparably harmed {flhe appellate division does not issue (he wril you are requesting: Inn... ' n,‘0'-I'II I' o 'oo.' Iii I . ‘ II. 0| I‘ll‘u .WW] without notice. Order You Are Asking the Appellate Division to Make ® l request mat this court (check andfill in all that apply): a. order the trial court to do the following (describe what. gfanything. you want the trial court to be ordered m do): 3(an 1h: mling QI 11.1de Overton; reassiQn the trial to a difi‘erent judge b; Older the trial court not to do me following (describe wim, ifanything. you wan the trial court Io be ‘ orderedNOT to do): wmx m1? pefifion for writ APP-151. Page 50¢ 7(MW. Infraction. or Limited cm: case) '9 6mm: Placencia v Superior Court 2 1 A P 03° 7 4 9 c. I issucasayorden'ngthetrial oourtnottotakeany fimheraction inthiscase untilthiscoundecides whether to giant or deny this petition (describe below why it is urgent (ha! the trial court no! take anyfiurher action and check the Stay requested box on Inge I ofthis form): l,i' ' , lefi without the benefit 0f a favorable decision upon apmal and lefi homeless m this COVID enviomment. l/My client: (l) D asked the trial court to stay thcsc proceedings, but the trial court denied this request (include in your supporting documents a copy ofthe trial court 's order denyingyour request for a stay) (2). did not ask the trial court to stay these proceedings for the following reasons (describe below whyyou did not ask the trial court m Slay these proceedings): The trial court entered a stay until 09/30/21 but rggmggg Mmaggs paymgm 19 Elajnfifl as a condition that is beyond the means of Defendant who h__as not yet been legally found to be unlawfully detaining. d.E take otherMon (describe): Supporting Documenm ® lsarecord ofwhatwas said inthe trial court aboutthcaction ormling youamchallcngingauachedasmquired by rule 8.93 l(b)( l)(D) ofthc California Rules ofConn? a. D Yes, a transcript or an official electronic recording ofwhat was said in the m'al court is attached. l c. D grant any additional xelicfthat the appellate division decides is fair and appmpriae. sigued under penalty of peljuxy) (Check (l) or (2): ( l)D stating the transcript or electronic recording has been ordered, the date it was ordered, and the date it is expected to be filed. (2). explaining why the transcript or official electronic mcolding is not available and providing a fair summary ofwhat was said in the trial court. including the petitioner‘s atguments and any mnem by the trial court supporting its ruling. b.Z No, a mscnpt or ofiicial electronic recording is not attached, bu: I have attached a declaration (amemem \ Wm“ 3°" Petition for Writ APP-151. P-o- 6 of 7 (Misamomor. Infraction. or Limited Civil ease) -) mm Appellate Division c N . Cmum} Placencia v Superior Court 2 1 A P o 80802Wrg ® Am me following documents attached a required by mic 8.93 ubxleHC): - The trial court ruling being challenged in this petition All documents md exhibits submincd to the tn'al coun supporting and opposmg die petm’oner‘s position Any other documents, or portions ofdowments submitted to the trial court mm ate necessaxy for a complete understanding offlw case and the ruling being challenged? (Check a or b): a.Z Yes, these documents arc attached. b_ No, these documents axe notmhed for the following masons (explain why these documents are not attachedand give afair summaty ofthe substance erhese documents. Note (Ml rule 8. 931 provides (hat. tn extraordinary circumstances. the petition may befiled without these documenls, but the petitioner mus! explain the urgency and the circumstances making the documents umvailable): Verification l declare under penalty ofpctjury under the laws ofthc Sm of California that the foregoing is true and com. Dam; 09/17/2021 Chn'stinc Placencia Type or printyour name mn‘afficfi’n‘owr or attorney “mu” Petition for Writ “-151. Paw 7°" (War, Infraction. or Limiud Civil Cue) MC-025 SHORT TITLE: “SE ”WBER_ Placencia v Superior Court 2 1 A P o o 2 7 4 9 MTACHMENT (Number): (This Attachment may be used with any Judia’al Council form.) I, Christine Placencia, state: On September 16, 2021, the trial court heard my motion for new trial regarding a trial that had occurred on September 3, 2021. I had never recieved notice of the September 3, 2021 trial by mail or any other means. I testified at the tn'al court that I had checked the court's register of actions regularly afier filing my Answer on July 13, 2021 but never saw a tn'al being scheduled nor the notice of tn'al being conducted filed into the case nor any proof of service of that notice of trial document. The trial court found that relying on the court's register of actions was unreasonable to be noticed of the trial date. The coun also found that I had recieved notice of the tn'al because it conducted it's own investigation into the reason the entries were missing fiom the court's register of actions and the clerk's ofi'lce located a notice it had purportedly mailed to me. However, this notice was not the notice used at the trial. The notice used at the trial by the court was attached to Plaintiff‘s oppposition to my ex parte application for a stay and advancing the hearing on my motion for new trial. 0n September 9. 2021 I filed my ex parte application to be heard on September 10, 2021. The court was unable to hear the ex parte that day and conitinued it until September 13, 2021. At the September 13, 2021 hearing, the court had technological difficulties and ordered the parties to return on September l6, 2021 Also during the September 13, 2021 hearing, the trial court remarked that the entries were missing in the register of actions and it would mquire of the clerk's oflice why the enm'es were missing. I had to pay $1866.62 to get a stay to have my applicaiton heard on September l6, 2021. I am required to pay a total of $2,700 to have a stay until September 30, 2021. This is manifestly unjust because the trial was not noticed to me and the judgment is void The court only "found" the proper notice by conducting it‘s own investigation into the matter and having the clerk's office produce a notice that was created afier the trial. l declareun d/Balty of perjury under the laws of the State of California that the foregoing ls true and t. E cuteow 17, 2021 at San Jose, California. /, Placencié, Declamnt (Ifme item that this Attachment concerns is made under penalty of perjury, all statements in this Page Attachment am made under penalty ofpequry.) (Add s as required) uoozs mu. Jay 1. zoos; to Judicial Council Form SUMMONS (cm:c.léN JuolcyAL) UNLAWFUL DETAINER-EVICTION (RETENCION ILICITA DE UN INMUEBLE-DESALOJO) NOTICE TO DEFENDANT: (AVISO AL DEMANDADO): YOU ARE BEING SUED BY PLAINTIFF: (LO ESTA DEMANDANDO EL DEMANDANTE): Mohammad Mustafa Christine Placcncia and DOES 1-10 CI IIILJ 10UV l’v FORWUSEMY (SOLOPARAUSODELACORTE) $ FiLED 1125/2024 6.08 Pl'v'l ¢Ierk of Court iuperior Court of CA, ounty of Santa Clara 1CV375631 ouiournd By D Harrislululv énvelope. 5709223 NOTICE! You have been sued. The court may decide againsx yew wiihnm ynur being heard. unless ynu respnnd within 5 days You have 5 DAYS. not counting Saturdays and Sundays and other judicial holidays. afler this summons and legal papers are sewed on you to file a written response at this court and have a copy served on the plaintiff. A Setter or phone cai wm noi protect you. Your written response must be in proper legal form if you want the court to hear your any". Tka. .nk HA!m ah Ht.we». Inna: Ina, u» u Cvulu Ivuu ulut ,vu' Wu us: nu ’c'uv' response. You can find these court forms and more information at the Califnmin Cnuns Online Self-Help Center (ww‘courtscagov/selfhelp), your county law library. or the courthouse nearest you. If you do no! file your response on lime‘ you may lose the case by default. and your wages, money. and property may be taken without further warning fmm the coun. Thule ale uiilel iegai quuimmellib. ‘I'uu may wani iu ca; an attorney right away. If you do not know an attorney. you may ................ aflomey, you may be eligible for free legal services from a nonprofit legal services progfam. You can locate these nonprofit groups at the California Legal Services website (waawhe/pcaorg), the California Couns Online Seif-Help Center (www.couflscagov/selflrelp). or by contacting your local court or county bar association. BEE |Alll\lCD- ll Cl “I AL- ulna, I-VW u 'yvu Ccuuu- yay' ule "mug ace 33a u-c ucvn Iv- a fee waiver fomL NOTE: The court has a statutory lien for waived feés and costs on any settlement or arbitration award of $10,000 or more in a civil case. The court's lien must be paid before the court will dismiss the case. ,‘AVISO! Usted ha sido demandado. Si no responds dentm de 5 dies. e! tribune! puede em§tir up fella 9r.- su contra sin Lina audiencia. Una vez que Ie entreguen esta ciracrén y papeles Iegales. solo tiene 5 DIAS, sin contar sa’bado y domingo y otms dias fenados del tribunal. para presenrar una respuesta por escrito en este tribunal y hacer que se entregue una copia al demandante‘ Una cana o una iiamaa’a rerefénica no io protege. Su respuest‘a por escrito tiene que ester en formato legal correcto si desea qua procesen 3;; 553:; an la cans. Cs pcsfble qua hays an fcnnulan'c que usfed pueda usar para su respuesta. Puede encontrar estos fonwlan‘os d9 Ia m”? y "vé-c I‘nfnrmacién en 9i Cent"? d9 Ayuda de Ias Cortes de California (www.sucorfecagov). en Ia biblioteca de [eves de su oondado o en Ia code que le auede ma's cerca. Si no presenta su respuesta a tiempo, puede perder el wso por falta de comparecencia y se le podra’ qurlar su sueldo. dinero y bienes sin ma‘s advertencia. Hay oiros requisiios iegaies‘ Es Iecomendabie qua iiama a un abogado inmediatamente Si no conoce a un abogado, puede llama; A ”a ogr- iaic An mm i..-”A a qbaacdnnaw u mu uvvvn; av u.“ nun": u nuv3.4uw . Si ns pucdc pager a un abogado, es posible que cumpla con Ios requisitos para obtaner servicios Iegales gratuitos de un programa de servicios Iegales sin fines de Iucro. Puede encontrar estos gmpos sin fines de Iucro en el sitio web de California Legal Services, (www.lawhelpcalifomia.ory). en eI Centro de Ayuda de las Cortes de California. (www.sucone.ca.gov) o ponie'ndose en contacts con Ia cone o eI ooleglo de abogados local. n-‘lu-u IA:uclvuléfv' 35 CUCTAS; 3/ nu [Justin pagul fa uuuia u'e presentacién pida al secretario de Ia corte que Ie dé un formulan‘o r49 evennmn do 11339 tie Cunézs Al_flsa Per leu Ia code Ofene derecho a reclamar Ias cuotas y los cosios exentos con un gravamen sabre cualquier cantidad de S10 000 é més recibida mediante un acuerdo o una concesién de amitraje en un caso de derecho civil. Tiene que pagar e! gravamen de Ia cone antes de que Ia aorta pueda desestimar el caso. 1. The name and address of the court is: .45.--.mi. 'A .1 (Er uvnluIC ll uuoumuu uD n'u writ; 63/. Superior Court of California County 0f Santa C lara |nl \l ncu!‘ l7! 1V. A lllSl S;l... qdll J\)SC \. l“ 7J1 IJ {CASE NUMBER (ndmem del caso): I 2". CV37553". 2. The name address and telephone number of plaintiffs anomey, or plaintiff without an afiomey. is: (El nombre, Ia direccién y eI n Gmom An bola‘nnn do! abnhadn dnlnuvuvav uv unvuv: Iv av: “auv sun uvruuuuuruv v uv Lco B. Sicgcl. Esq. (State Bar # 11684l) hM A \-HNMN‘“M A "'3! demmda...s qua ..c sens: :ycgcuc $3,: Phone No"' (831) 768-9] 10 STONE - SiEGEL LAW FiRM. i726 Scabright Avc.‘ Sunlu Cruz, CA 95032 Fax No; (33 i) 713-3797 M01 d2 FarmAW lnrMauwmmv Ilsa o nnunu I nu nuII-I u I-w-Anuf F; nfinu r3355 2g cggfixnge. t: ‘12-)" 415 4:: ‘357 ' . . l: “mam“ SummumS-quwmvvrm. Dc IquLR-cv'ka nun MC “W SWBO (Rev.SW ‘l . 20W] I.¢:\'i\.\'l'xis R Annmmlal ( bh/bnoumliciuI ( ’mmcil Farms MNT'FF (”8””)? Mohammad Mustafa DEFENDANT (Name)- Christinc Placcncia‘ ct al. a (Must be answered in all cases) An unIawful detainer assistant (Bus. & Prof. Code, §§ 6400-641 5) x I did not |__l did for compensation give advice or assistance with this form. (If plaintiff has received any help or advice for pay from an unlawful detainer assistant. complete item 6 on the next page.) 4. Unlawful detainer assismm (complete if plaintifi has received any help or advice for pay from an untawful detainer assistant): a. Assistant's name: b. Te!ephcne 9.0.: c_ Street address. city. and zip: d. County of registration: e. Registration no.2 f. Registration expires on (date) : ha.“ 4 If): Ifin’34 R-no BIA Plank n3 f‘nnp‘ f‘larlv h" h l l...-..:.. flan..."“‘"m II‘UI LULI U.UU l IVI VIGI n Ul UV I l '“"'"' "'1 _ IJ I lalll§ ' ””9"", fecha) (Secretano) (Adjuntoz (I-or proof or serwce or tms summons, use Proof ot SerVIce ot Summons (form POS-U1U).) (Para prueba de entrega de esta citau'o'n use eI formulario Proof of Service of Summons (form POS-O10).) 5. NOTICE TO THE PERSON SERVED: You are served a. E as an individual defendant. b. E as the person sued under the fictitious name of (specify): c. E] as an occupant. d. E on behalf of (specify): under: [-7 CCP 416.10 (corporation). m CCP 416.60 (minor).E CCP 416.20 (defunct corporation). D CCP 416.70 (conservatee).E CCP 416.40 (association or partnefship).E CCP 416.90 (authorized person).E CCP 415.46 (occupant). E other(specify): e. l. .l by petsonal delivery on (date): SW”m“W “ ”‘9‘ summons-UNLAWFUL DETAINER-Ewcnon P'“ 2°” y ‘I' ~v~ I... ..rl"l'i. u I r-rl“ Alf“.LQHJJL‘JL) r :uuvlnuuuu l nu}!!! (nu .Inuluu: I. mun. u A w "Ly 2;) ’.u-\'.A<\...:‘-.\. “wul- |,\\’ i). ‘lkék‘. -‘(\|lk Nd “'. |I“\“1 , \hxéuk! l . Nflxk. 51.5“ H.” \U. Jinn“ \‘I$\'l \l‘l'l I '.'\“ IVI)‘.IHhxx -~n~u,xl \n :u\\; x"* ' . x ’_<‘ \L\Lnn:_'!1 \‘ x 1‘ 5' , O ' l: flrumm x iu/J \ 4.4m- (<3; -1 _ ‘I Exmximiic kn!”- n‘ xg’gdhicg‘cixll'g 832 “‘33-5’7'.‘ Icicphum‘ 3-: " \mec} l'nx' i’LumiE} \H ‘§i.‘\\1\1 \i) \H M \i \ k ,‘H H I H{\'i \.\l Hutu!“ Hi k: HE (Hi \H U1 .\\\1 \H \EUHHHHIHH MM ‘x. < \xl \w. f’hzmzxit. \li \ 21' E-F!LED 1/25/2021 6:08 PM Cierk of Court Superior Court of CA, County of Santa Clara 2‘! 0.1375631. Reviewed By: D Harris a}: v37563 'i (HUN _\l\l IHR! \E \\\li l. DIJ \I\i'.R (H|~“J\H\i i’l \( i \( i ‘x‘ .md 2M Di .\ E-W. muluxzw. :~-: \ x I i lk'ik‘llmLZE’J‘ .2 :" u'. .i’mmlzh‘ .lnhggx i. [’izaimii-"Z'. \U )i i.\\i\i \l > \ii \ i “\l \ « l‘swczmzlu "l’IuinLETIW. Lam indix lduul zoiding in mu \JamuLI L mam}. L .mlu:‘nm 3. HM: rum prupu'l}. Puvcwmn us' uim‘i. ix ur-zxgm m aim ‘xiiwn. ix lnwlui in \miu ( him I \Lurflcx igu l)r._ \m Jnxg, (' \ “5 . 4X .‘\m(.z{ :.u;‘.( mum? L wind: dunk \usgwm‘k I’drcd \umhcr (35441-‘3-4n ihgz'cil’;uii..'l‘ "liig i’sx-pm} ‘ V ihc 1m: «Luna am! gnawing: n: .‘hwx l 1L ihu’cfmc \uo mci: ucltmmm mxm’ mm ziu‘uumh numw mum“: an \xl‘xun -+ 74+ ul 1m: k mic u! L nnaznx _ \Luic nH .mznrm.:. m Inc 5mm g-vnkntwgi ?ixuixm It\HH H." HM) m x: x “u H i \(‘3 i I) Muumwu u |}l.x_ Ln'; prcxcmi) unknmm 1v l’LumH. \xhn RWUM H! >\ . . .N-fi .uv-Ixut. .mu mgunu‘nunh duumuj ‘15, _~n§_ :; § 4 ; J . I 4 , . ~ , .. ; r ; r Z C L . , ; A . 1 . . . v * f r : L l r r .. T I . , r C . 7 . 4 . . . . ‘ _ _ , . . . . . ‘ . . . . ‘ . ‘ . . . ~ . m r r - p u ‘ . . ( u . . r .. ., r _ . / I ’ L C L . ” L . 7 : T : . L . f : : : . ~ ( F : ~ Y ~ : F L : r . . : . : : - a . “ , I . . . . _ _ . 5 - 2 7 : : .. _ . . . p . I ; . . , . . . . 1 . « : 2 2 / _ :. . 1 . . 1 3 , . . . L 1 _ _ Z . 4 ~ r , r 7. . . _ . 1 ” . 7. « _ . ~ . l _. r . ~ ~ . . L : . F ; r . : : . : , n u J 1 ) _ . .. . . . I 4 1 2 } . . . . 1 7 . l l l J ” 2 7 ;. “ L t i l f f. " : - / L _ r . r. C _ : L : _ r . L . 2 ~ . ‘ . u J r . . . . _ . n t . _ . ; . . v y ‘ . _ C a n ; : _ ” : 7 ” 9 : 9 . 1 / 3 ; : 7 2 , i . : 3 5 . r 2 9 5 3 : : v : 7 . : . : .. F . _ $ 2 2 3 3 2 . ? S C E E : r 3 7 m J m T L . ‘ y _ . y . .H m V i _ x » : r . 7 2 : 1 3 , ? : c . 1 : 7. 3 2 . 5 . 2 . E 7 9 3m m . f m , x h m w 3 2 . n : . , :, 7 . _ : r . _ , . . . : L , : : T . x I ? . . . ? E c p E E z I c i c n w U n n r : 3 : : y i n 9 . 2 / 3 3 w. ” : 7. E 3 2 : 3 . . . . . r 2 3 9 6 . 5 2 . E S . E . r i . 5 : 7 7 , 6 2 5 3 s _ E S n », 2 : 3 E 1 . 5 : : E 3 1 . . C a n n i n g . 2 . L 3 ; F r : 7 2 5 3 2 2 / : _ : . 3 r . _ . “ L n f a u E x . . r C i “ , E : V : 3 : 1 3 5 ; I n c ; . " 4 i : 7 : 4 7 . . _ : . : .. : r . r w 5 2 . 1 : , 7 T 1 2 3 : _ . . 1 3 : 5 : . F . L : : . r . r _ : 2 } . N : : 7 . 3 2 5 1 . , : 2 : : 7 w a n s n a n x l c x . 2 . 7. r . ., . r. r . : 7 : . z , x. 7 . 1 . : r . : r. _ . : ¢ 2 7 7 . “ . : 7. 7 ; . r . r . _ : v r . ; C a n ; 3 I d ; 2 : C m a n z . e r . " 4. 6. 2 :. . . 5 : : ? E E C a n ; 9 : ? - C u r fi i i . _ . . - : . .. : . : 3 2 : 3 7 ? . S z d h z E : h fl : . : r . : : Z u n i » ? c ; 7 : 5 , : C E fl 2 : 5 2 : C ?. S E E f . “ : 1 5 . . 7 : 7 : . r . : c § / : . u . +_ . , 5 c _ r r ;. . . z L F . E 7 ; , W 5 & 2 r 5 3 C ” 3 , 3 5 : 1 5 7 : : # 7 5, ; 7 . , sz fi r d . 3 : 7 1 p 1 3 : 1 2 : : . 7 7 1 : 3 : u : ~ . 1 . 9 : 5 . . . 7 2 : 2 2 . 2 9 . . 5 5 ? . r fi a / : 2 ; : 7 . . . « . .. E. , E c m r ; S i. L S n : 3 ? 2 ,. : 7. 1 : ? C n e n z r r z z E k » 7 / » M x . . . , : . , : . F. , ; .. _ . , . 2 . 2 1 . 2 7 5 7 . “ S r . . r d } .. . . E L r z w d i v c g : 1 3 : 7 v Z r . : z y m c n . 5 5 2 : 7. . 2 2 3 7 ? C a r » . 2 3 . 7 . : 3 : . 3 3 . 2 m m ; E 3 2 : 7 1 : : 3 E r. 3 . 6 2 : , 2 7. 3 3 8 . : 2 . .. _ z : : , : _ w . . I 5 1 7 . 3 5 : 1 : 5 : 7 2 r . 3 r . J u i c y L i : 3 r . ?. : . r : : E 1 ~ / . a / 2 : : . 3 x : . : 7 3 ? r . ? . f / i l t s a T S P , 7 2 : ? r . 8 7 : . x ” : 7 . . 5 ; f i n ? (. 2 3 2 E r. / : : c r. r . C E . 7 E r F r n a. E 5 7 . 2 . : F. { E m a E C c : . 3 7 £ 2 8 E E r . “ ? : ch m 5 ; E n g 7 .. . : 2 : . 7 5 2 . . . . 3 2 . , r 7 }, B a ; 3 E r . 3 5 1 ? : 3 . 2 . ; 2 m J r . ” , _ 7 d . ; Z ; F . ; , 7 T 1 5 : - . 9 l ~ r : 7 . { i n c . E C 2 ,. : 2 : 5 , 7 £ 2 3 E S : L a f i u i . Z fi * / r C . 2 : ; c : 2 : A . 5 2 7 E 1 . 7 ;. r / v : 5 r 2 3 2 ; E 3 F, r i g . 2, : 7. L 5 2 : . r 3 3 : » w . . 1 . : 1 . T : : . , . i ; . r . 7 : r . . r . . . £ ., : : 3. 7 7 : 7 1 3 : ; _ . 4 , . . . . . . . . . . . V .3 : 7 : r . L E I : r : . 3 . i 9 1 2 : l E r H : 7 1 : .. : m _ : : : L L w M _ 2 ‘ : 77 ” , c , _ . £ ; , : : 4 _ 7. 7 5 7. . 7 ; . : 7 . : v r . . . . r. r . . . : / : _. r . , / 2 E r . 3 5 7 , 2 . » 7 : 7 . L 2 : i . J ? . r . . . fi n ; . fl u M ~ l\.|..--‘A.vl)l\:l\tl"x .I.n.¢1._H.:,..I. ._.'L. _nruumum :1 n x u I \ ‘unmnnnLIULHHUHlilclu‘l lungx . . J 1MIxuuxxu wk u...-.~. .3 u ..'3.‘.‘.,;....I.... *‘ ‘\.~\' AL i‘ .l', I\_.'v lA . 'nu~ungu m nu“ “n. Mus.» .uuumn_~ x,'. _.-v_ n. um. w munduLh Ldu>Lu x'\ IIxILHumH \\IH u‘mllHtC 10 .,.... L. .... ‘ -_ ‘ .. t ‘L 1 . . _ " ;.\p 'dnuux “i Km. mun; 1mg “I mu; ‘n Ikhmmm xuxmnh m p\v\\\\w.z Ui Mg HUi‘LHL r. n v 'x r ._.‘- ' ..lx ,.;.. U 7. [LUFUAHH U}! \lUL.HLC K «K&L- JkklIUL\ '1, _ .IHU 4.‘.‘.| immuiz mugs mm. u! :imc nz'u'iui. i1; mii lcquni ma; .iudmui amnicc iw auscn nl' 1h: ccz' H'mi cup} u! Lhc i‘iuimil‘z's pruducxmn":~' iumcc x Dun E pm} ‘Suic and l'nc i‘iuizuil‘t‘x mum ikui rucrrcd m Jhuw in puzzlgmpi‘. 4» nI‘I'nix (hmpikmtz. \'\ iii'iii'i \Héi .i'iuin:il‘s'pzx:p m:‘.iw;11mnagmw iluum;uzii'1 .ru i \t I.~\.und \mnncrs m 2‘n~\.L‘\.~m;L u? mg t':‘=*;‘~:12\ ax jn:,‘m\x: 1 iurwxwxniwlwl mu k’mpcru Sumini H: \mlufl x;n‘.x( uuuiyk uhhu‘nm.cummun} kmmn’ ¥ Lb 30.“; Siwpm Er“ iha. \m .iuuw \ ‘JM 4N. \mm: hum \xxcwurx l‘all';cl \mehcr l\.‘4--o_'-l1~‘ilv; i i Hr dmnugo iur ihc unhm m! dcmmcr u: Inc l‘mwrz} v.3. mu 111:; v.1 \f a i \ ~' gvcru‘J) :xgmmi; A Hclundum 1’1 \i t \(. I \_ 4nd .\:2 ‘ finch m f’wuoxmn u! :hc i’rupczfi}. 2mm (Hui uncl .Lmuur} 33. JUL}. mu cxgmuium oi luv \umcc 1n Um: nxkiu'rjdzig mm I ’wmpéumx. 59.1.2; lhc duk- Judgnmu M '2 c1 {crud hcx'cm. nmnm :u 1m- xum ..xt' xfimin UH. :‘ixc anuxzmum iurhdulmnal mm: u! um ( nun. Maxim”; :‘cscz'wx mc rzgzn J.» punuc .m) dmcrcmc m :i‘ q :‘munchujx ‘Limngx ’t’Ltjmm‘mmrx lin‘nxugh Hcicndml x cununuca zqug‘ulic} n} (h: l’:'u;‘ur:} thmu-‘Jh .x sunning ma H .xchL 3 lm' PLImUH ~ pmlx u: smt; in: nun} alloy: mud :un;m z'x'i'ic.’ ;L~ mc k nun \icm‘m gm: Ami pz‘upcz’, Hahn? Mum?) 3}. 3H3? \i(.‘\l ' \H luH l ”\\\ HRH l 0’ H \K’L‘J‘ g} z‘.,}:\ v ‘vt V , \ hm H. Mogul. \Uus'mx In!" Phinzxf}. UMumxsnad \hhxuiu ‘ ,. uy VI ‘ v_n '\ ‘ V1!Hmr: \h! EHRE \3 \‘.‘..» i .3. I‘..\. .\ z:A\.: ‘ ""1.t l .1¢l‘\¥taux”!3"!um;xg\.' t; EXHIBIT .yxg-hsA m v . x . 4 n H . x. w H . , _ 1 . 4 7 n f . K w H l . ._ J, 4 . , h fi X ‘ . . ‘ z ‘ a ) l 1 . . \ _ . . W ” s “ \ _ u . x , “Thus document was electmmmlly suhmmed lo Santa Ciara County for recording" 24358408 Regina Alcomendras ‘J .- :13 .ZL ‘Y‘. '_v: 'K "":-;'J:' RECORDING REQUESTED EY ' LBS Lak'J LL: ' ‘.45 L .5355 L’ IND 'J'v'i‘iiw RECORDED 7i} ‘ _. Caiiber Home Loans ‘ .gst n»-..Maui ‘vv'ireiess Way Oklahoma CRy, 0K 73134-2500 Forward Tax Statements to address: Same as ab0ve . .__.__--.,.. -':-’r-k,: 51-5th LJNE FIR 3:17;;JRDER'S L57; Qfx. v; A7” 654 42046 4a. I v.7: DcIJLLHL; 1 TRUSTEE'S DEED UPC!" SALE 4- ~ N 654-42-046 ?Iars‘e: Tax: $0.00 “*«IS ‘RANSAC «Lb. :5 £-x:‘-x'~rr Luam‘ rs Reupwezxéms CF ‘rE RE «EMF. tux: ‘A.x:fi':;r.‘ (333}. :1?d :QN ~33 "516 Grar‘tec Ha'em was {‘6 -: e3. :5 fig.v_«r ref s: a'- me Amer: 2" T'xe unpa-a Dept wr-s851.354.732.06 Tn? ’mc ' r' a c By Tm; Gravee I :51.354 732.06 Sad P ope’t, ls ln The City of SAN JOSE C;.z ?z.‘ o? Santa Ctara ZBS Law LLP fka Zieve Brodnax 8. Steele LLP as Tastes. ;-: :ereas s: :es:g1*a1ed m me Deed 0t Tr s: r‘e'e 'rcer mom ya 11;“ arw sass: be: c: -s a n. t z Ls..r‘zeu Tr usiee: soes nerebv GRANT and CONVEY lo U.SA Bank Trust N“.A as Trustee for LSF10 Master Participation Trust mereln cast: Grartee, Du: .xmou. ;;.5( at ' :r ma rartv exsreusecc :1". :ieL. ah rgr‘. t'l e and ute‘est come; ea. :c 5’1: "cw :3 :3, .as watee J .ue' ~' e Dee: ’Txus: m :10 .u . .e property smate: ' :P'e count» 3? Santa Clara 81:23 c CALJFORNIA cescr 32:1 as "0 ows LOT 129 OF TRACT NO. 5931 IN THE CIT Y OF SAN JOSE COUNTY OF SANTA CLARA STATE OF CALIFORNIA AS SHOWN ON MAP FILED BOOK 400, PAGE 46 AND 47 OF MAPS. IN THE OFFICE OF THE COUNTY RECORDER OF SAID COUNTY. P‘cpe‘fy Aad’ess 3552: " wan.-. ‘JF. SAN JOSE, Ca' ?'O'WB 9:316 'ms csrfveyance s mafia 7‘ com: afisc w»: ie te." s a: c 3 cvxsc. 5 o! n:- ace; 3 lrus: exams: Uy CHRISTINE PLASCENCM. AN UNMARRIED WOMAN as 'E msto' “3:93 11/3012006 N' rr‘e"v :ca Reye'ss f. u er‘o 63 a. e Renae: c Santa Clara Va crrte M32! :re auzrrcrxy ar e :c.vers \.es:e: r: tr-e T' zstee cesgr‘ate ‘ * 2M:- rte: 0f E “ 3r 3&1 t".=: Ln; assorted “'Jszee ae‘aJ-t tau f‘ occar'ed unde' me Deed :r T. s: pufsn-n :tnz. \istca 3 ye euiiam E‘esrasr‘z: Sc .. ce e Dewur’ :zpsx 'eccrcec cr 12/8/2006. as Instrument No. 19217545. The subject Deed of Trust was modified by Loan Modification Agreement recorded as insuumeni 22739639 anu‘ recorded on ?GHMZGH, ;, 0*‘aiai records 'This instrument. is Demo recorded as an ACCOMMODATION ONLY. with no Representation as m its efi’m upon title“ TRUSTEES DEED UPON SALE TS # 17-50124 Orc’er 3 170482776-CA-VOI 4km».Mph .1 Cuuiuuup qr!'7“ L stee ’a-gmr. compi ea :v a. app cable s an. C y :eQJ 'ervzers :l '.".-- S.ate c Ca lfom a ano peuormed . 5.. _, G days after 'rs 'eccrdmca a.. 1“,.HA‘ --.h. .rfi h‘. - 5 an uu..'.; ' " " F “A '\ f" “H“ I-I .f" fin A S: \"u’vrfir. yennvv I ‘45. ‘ vvlvc‘l g SC-I3-hd z; rivu u» u- ukuu.‘ . gun“ _u.v yr. .uc- a N3Lce o? Sa'e a: ieas‘. Iv. er? :ays pnsr to 're Se e Da:e by cemfieo ma: L u castage p:e-;la;d :a each 2573:: a‘zzac: nous: :r. :3":;::-:rcc "3:? Ca farm: r‘ Cede 252 i: AI. rec... rements per Ca:-f5r" a Sza 43:5 .cgs. c. g :hc man ng 33:33:13: :c :ch 3:13 2.3 .331. 3". 3f :cpzes of \lotsce or’ Default and ElcA on to Se unde' Deec cf Tusx and Non:e cf T'Jstee s Saie, and me 305mg .»« n "n n-mrm-r.’ .. .bpc am nu-.. cmwnw Tusicc. In 03'71313nce v.11" =31: Notzze ‘1‘ a c - e : ts ps..ers unae' sat: Sees of Tusk sold sa‘c 'ea‘ p'cceny at po 'ch: aLstm 0-“. 12/11/2313 3a. Lee, :e : .5 t, e r‘ gist 2.33:! a: 3-3.: s: c 32:3”: 1:5 34:,“259: 37' 3:2: usp 1y for t'e a'rcwt cad :e «g $1 354.732 06 m. .. u! "crey cf 1w: d: tea Szaias m cm aer 'ece p‘. tm'ecf a acres,‘ a:anawiczgss r. .‘-_-::.':.a. ya saztsfa::.:n 3.‘ 2h: :‘c‘z’. 332::2 t, M“ Wee: cf 'r‘ C' Date. 12/231201 9 A '33:;W-" .2: J: J" «2' ‘.-'~s ‘3;C.." :‘ ’ u "kl 1,. ‘ u.. 9.....44 . __~ 'w ncIu.: 21c. x mu; 'x; mm mmm‘ i'u: ”.L paw: mi) a; pc; cap x u ic:.uun. Mm punm‘ m m.g- ‘m2: « x mmumh cx ucnw :u nu tn: gm um a .\:ms: a_mciv :5 J: sabrcnmd Lu UI: \\: mu ixzxinnrficnl and .:.c_\ :wgucu \..: :y;11.L‘ m “s: ..:. .m‘x J .\..w IcL L...‘.-.g.n_\n um. .kuu 2.6.1; x";- :;:$ ha :1“. -rx :iummms, on tn-cz:5"an; :H: .; pcm‘...' 2 ~:. inc curt.) 4pm :2c..;m u: Am... .hu gunman) .zuui. L \L‘uJL'h bx; . n. ....'.\ul uumxt n.» ...-.'J u. .n'» 3:12; J..I\I \UU‘L’.L. \K'i'Z'FJKS m1. Q, , 11nd 02.23, “L“Ln: a ‘ "1 n nwrsl.mhlfibc'wfim\ 2 aim s! wi'vuV}!“131' EXHIBIT I , 3 t . 4 h _ . k. o; . . H . i ‘ V 2 4. T 1 . . \. J ) . 1 2 . . , J a . . x v ‘ I x : 1 1 x. t : 5 | - x y ) i - 4 . .. 2.. s. n N _ w w a . " (ms document was electronicany Quhmmnn m Santa Clara County tor tecordmg“ 24?59045 Regina A lcomend ras RECORDING REQUESTED BY: ‘ , ,,. . .p i ““““ First Amerzcan Title Ccmpany - ’ ’ - ' ~ n ' MAIL TAX STATEMENT " , V, AND WHEN RECORDED M...L DOCUMENT To: - 1 ,j‘ j ‘ :v‘kchan rad.‘ ins:afa I z:. ‘6 I l s: (LH ‘ n C I ( ‘1 _5:34;; :SJVL‘ Thu Lnr' I1 P. N.’ 051'”; L40 File 9.0.1 0105-3451235 {Yb} GRANT DEED ‘.>a,«_.":'ai;-kr .-'J-':;-’:- Iom' Z.” " -. ' TrA ufl ALMC 0h {p ML A F7»; " 1‘ t I x . " ~- : ‘ 9 v -‘1 fl ”V - a ' _' u » x San )osc . k ?Li. ' '“ | “ $4.143!” “492-: ;__'-‘._..‘é":..’:.,:._:.-_'.__‘;L_.-.‘_‘_ ’ ‘- - :-"’".-_.e.‘.:.'- (“H . ‘ -' - \\gé" ‘ N- - ::"l'i<‘|.'v V' r1 r FOP A VALUAB-E CCNSEDERKHCH. FeCEW/L Of wmch :5 heresy aLKnawlcflgdu, U..S BANK TRUST, N.A., A5 TRUSTEE FOR LSFIO MASTER PARTICIPATION TRUST harem {aim x o Mohammad Mustafa, an unmarried man the fnmwmg nagrrirn'éc nmpes‘ry m. 1-30 City c?" San Jose i‘rmr‘vt'y 47f Santa Clara. Stats: Cf California: LC u 129, AS 5H0.N CH THAT CF." AI.‘ LAP “F TRACT N0. 5931, MHZ". “ MAP WAS FIL-‘D FOR RECORD m THE OFFICE or TH RecoRDER o THE COUNTY 0F SANTA CLARA, STATE or caurokma or: :UL‘.’ 25, 1977 , m socK 400 0F MAPS, .DACEIS) 45AND»: Grant Deed - contmuec Date, 12/17/2620 A.P,N.: 65442-046 Fxle No.2 0106-6452226 (YS) Dated; December 17, 2020 U.S.Bank, N.A., As T'ustee For LSFIU Master Partzcxpatxon Trust BY: Hudson Homes Management, LLC, as Attorney 1n Fact ' 83" '*,::13__.-A Autaonzed Signator / Fuetyn Wad‘nam A mal-‘ry Dusfzc or other officer campletmg m s 0:11! cate verifies mly the :denmy 0f the rccwxauai wrvc ssgwcec WL- dccument to which this certrficaze .5 dttddwu_ anti nu‘. t‘u-r ar L_K . ~.<- ... .‘ .q ,-.',A~ ¢{h1q-t -t-~ A .. x up)”, .A:>>, au.x.:a€y. m vu .uuy w mm “m.gd 'c u STAT?“ CC IEIAS ’55 COUNT! Cr? DALLAS m V _1 0“ 9592':ij 8 -2329m‘,’ ,__ H, ‘Ut‘tfwé me, __ ?;qu Keigx _-_ _ ,F'a‘uiry‘ ?uabc, paiscn-‘ai, appear:- Fveiy". Vvalmaka A __ > r __ ___' A F V“ V ___~__«M wnu moved {u mu un ihe bags uf satisfactcxy cwduzuue to be the persenfi.) flimsy eames) isfare subscrtu’d :3 the mhm mmument and acknowledged to me that he/she/Lhey executed me same m hm‘her/mexr eummized capacnyiees}, and that by hiclhgr/vhmr tugnzh-vmic‘: rm nu: -p=h-umarw Nun gprcnnidv fir Ohn nanh’: n:nn nnhmf r! uu-nrh run pnrgmic) arm“, nynraflofl rhn_,. .w. .., ........._ _., -.. .h- ........ .._... -.,..,.. _.4. - -U- “H-“ .. .. V-.-” -. ..-. -... - ., .. ..... _ ..... -U- :sttrgz-vew I cemfy under PENALTY OF PtFUURY under me taws of me Smte of Calciomaa that mu forcgomg paragraan us true and coqect. -..e-~.--~ .. q .... .mmfl .- 7v. . , H ‘. .r ._-.....‘.._. . . H2 1:11.}: my :oaxlu ouu umum 311m. nu.» gum IL/ wnum tramway x‘ct. , 4, ».\ l .YI ,x , , . l ; . L ....LLS {842' ,, . .... _- 3-..-.- _ ”--.“-V. .. Notary Signature _; pauga Kane), mgr. 2 EXHIBIT 3 I.‘ .Ihxix ’ 1. . ‘.l<\l\'"v .\kl'.)\..‘.13:11 \i THREE DAY NOTICE 1‘0 L‘H' (C(‘P Section 11612!) TO: CHRISTINE PLASCENCIA. and m ail others m possession: WITHIN THREE DAYS after the dale ofserwce upon you of this NOTICE, you are required to quit and deliver up possession of the nereinafter described premises m the below named owner of said premises. THE PREMISES which you arc vucupying have been foredoscd upvn and iii}: has ban transfarrcd to the below named owner and you an: lhcrcforc required. pursuant to the prowsions ofCaIifox-nia Code of Civil Procedure Sccixon I Lb! a. x0 \acatc. said premises. YOUR FAILURE m comply with this NOTICE will resull m [he immediate institution 0f Regal proceedings agams: you t0. recover possess Ion of 52nd prcmiscs. danmgca fur unlawful ddamer, and court costs. Should you fan m comply wuh [ms NOTICE. an uni. M'ul detamur action wii‘z be commenced against you pursuant lo I'm: provxazons ul’Cam‘umia (lode of Civxl Procedtue ‘ SUPPLEMENTAL ALLEGATIONS-UNLAWFUL DETAINER UD~1 01 PLAlNTIFF‘ Mohammad Musfiafa Aw V. um a l DEFENDANT Cbrzstznc ??accnzm 4 Federai {aw aiiegafion: a [Complete this Item If action med before December .31. 2020) Defendant VVVVV has 7“”! has not prowded a statemen! under penalty oi penury for me Centers Ior Olsease Como: ano Prevention s ozoer ior Temporary Han m Ewcnons :0 Prevent Funher Spread o! COVlD-79 {85 Feoerai Register 55292) (Note m plainlrfl‘ Proceedmg in violation of me federal order may .cszu': 1n cu. .‘i o; .:-i.-n.).al panalzxés I b. Thns acuon iw- does ' x ‘ does not seek possession of a dweihng um! m prepeny :hal 'nas a federally backed multilarndy mortgage ior wmcn forbearance ‘nas oeen grantee under :me i5 u'mzeo S‘ates Cone sectson 9057 ‘1) Date forbearance began (2‘; Dale forbearance ended 5 qu Uniawfui deiainer nuiiue expited before March i. 2023 The unlawful detamer compla m m Hus action is based 50!er on a nonce to Gun. to pay cr quit. or to perform covenants cr 3:1 :n awn" the Mme pencd spec:§:cd in the :tct‘ce exazred bemrc March 1, 2020 ll! 91's :s :hr: 9113' basys for the 25!:an n9 further :tems on (hrs form need lo be compietec! except the s:gnature and venficatmn on page 4. (Code Cm Proc 5 1179 03 5(a): 7) n 6 'P“ " Rent or other financial obligations due between March 1. 2020. and August 31. 2020 (protected time period) Th. ‘l..l I n. .. ...-~.._v‘.u Ju‘. «A ... L~,..,J ..\...-. fir...» -..,nA-..~.Al-a.‘~.~.-fi- At --\¢u avnohno Avlc u Mani.» uczalilct bunltpbau-ll nu nub aLuLA. I: uaacu‘ an 'caal MI HOAL UH a uC-Iva'lu nu yoyulcnl U0 ICII. UI unit.- oo igatlons due m me proxectec' tame penod. (Check ail mar apply 7 '." ) R l: Defendant {name each, was serves the ‘Nouce from me State o! Canfomia" requred uy Cone of Cum Droceoure sectxon 1179.04. and st more than one de'enoant. on W3 same r42": 3N! -n W: same man"? :‘P'C we mformaf'o" leger'jmg 99mm? 0' "vs notice m "em 8 below! DY ;:‘_ One or more defenuanzs was served wm! [he nouce m .Iem 63 on a antigen! Gate or m a diflerenl manner. wmcn service Is descnuea .n a(tacnmen: m c. '7 Defender" mama each) 32-3: sewed ‘.-.::.' v.1 :ccs‘. 15 :2; rs' noucc :3 pm, rent 3r cans: franc a! calgmzons. qua: or dehrcr a dcdaratzcn. ans an unmgncc declaratxon of COVlD-19~reiated Imancxa. ousx'ess‘ :n me. f0'n‘. aw wun the comem reaJureo m Cooe of Cm! Procedure sechon 1179 03(03 ano m. {Ii me notice Idenlr'hoo defenaan! as a m‘gh-income tenant :m') r'euueszeu sucnussuz-n o! documentation Supporting an; «Icciamivw' it'lc' dcféirdain‘ bubmu‘s. comwe‘z‘e :it’I‘I} 9 DEIOW (Code Cw PIDL’ § i779.02'.5u25.}) (Ir flung form UDJOO wnh mls form and Alem 6c is checxed speedy mis 15-day notice :n item 9a17; on form UD-100. anacn a copy or me nonce m Ina! compiamr rorm emu pro wile an requeslea mrcrmatwn aoou! service on that form! d. Response Io fiotxce (cheek ai.’ Ina! amw, t1) L_w Defendant (name each dewereo' a dectarauon of COWD-19-retazed finar‘cial ustress on randiord m me xxme reqawed ‘Code Cw Proc. R 1170 n'lm -, . _-. . . ‘2; '__: Defendant (name 93cm d c not dehver a deciaranor. of COVIO-ig‘ retated tv-ancmi distress on ,anolarc m the nmc required {Code C-v Proc . § I179 03m z 7 a ' Rent or other financial obligations due between September 1. 2020. and January 31. 2021 (the transition time period) The unlawful detamer commai'n m (hrs achon «s oased‘ a: ieast m par! on a demand for payment of rent or other financral obl‘ganons due dunng the transmon tune penoc 3. k_ Defercammame each; was servec me ”Notice Iro'u me State of Cantorrta“ reqmred uv Code of Own Procedure semmn 1 1 f9 04. ar‘d '1 more man one uelendam. on lhe same daxe anc :x‘. me same manner tP/owde mformauon regarding salwce of this notice m :tem 8 below.) . w. pLAINTIFF's MANDATORY COVER SHEET AND mm“ SUPPLEMENTAL ALLEGATious-UNLAWFUL DETAiNER _ _ H UD-101 PLAINTIFF Mohammad Mustala ~ '~ - ‘J fl...“ .7” ;,,. b‘ 2" h- One 0r more oefenaams was serveo wun me nouce r. Item 7a on a omerent Gate or m a ameren! manner. wmch servnce ss oescnbed m attachment 8c. C d. Defendant meme each! W35 SGFVEU WI!“ 31 1935‘ 15 days “ONCE ‘0 Day rent or omer {manual obéigamfls. qua. or dehver a declarauon. and an unsvgnec declarahon of COVID-tQ-reiated linancna! dastress m the form anu w:lh the comer! reqwred m Code oi Cum Procedure semen 1179 03m; and VJ} .‘I.’ the nohce Identified defendant as a high-income tenant and requested subnnssmn of documenlanon supoomnq any declaration the defendant subrmts. complete Item 9 below (Code Civr Proc. § 1:79 02 5(0),); Hf fn‘mg fnnn UD-HW} With (ms form and umn fir m rnm-mart snowfy rhm 15-day nnmfn m mom 9;:ng nn form Llama aggacn a copy o! the nonce (o mat complaint form. and pmwae all reauestea‘ infarmatmn aoouz serwce on ma! form I phr”. n«- ~ > av.“ ‘ucopvwa'tu A Hui apply!(1 (1 ) Defendant (name each» ueewered a declaration of COVID-19~renated finanCIai d‘stress on me Iandiord m the time reautred. uCode Cw. Prom § Hie uatin (2) ’ Defendant (name eacm. and not deuver a deczarallon of COVID-IQ-relazea fmanmal distress on me sandgord .n me ume reqmred .Coda Cw‘ Proc . §1179.03m.;; ‘ 1 Ron}g9 dun irhnipfu‘a nvvh. [I grunt. (-y'crv' aim” .1")..an '31 94")1‘ uvv V... . . v“. mu, .. “v...” w-.. .....v. yummu.’ fl. - ., i1) Rem m \he amount of S was due between September I 2020 and January 31. 2021 (2'1 Payment of S for ma: period was recewcd Dy Ja'wua'y 31, 2C121 Service of Code n! Civil Pmcednm Saminn 1179.04 Notice From me Stage 9f Caggfgmja {gnggk a]: mg! 31095;; a L The nuluce idezmfied m :{em Ba and 7a was served on the defendant fiamec m those dems as follows (1) By oersonally handmg a copy m de‘enuan! cm Idem (2) L_ _: By ‘eavmg a copy wm" {name w description) a person of surname age ano mscretlon. on (dareb a: defendam's “I reszderce i‘mi busmess AND maqu a copv Io defendant a! defendam‘s mace of reSxdence «.33 L___; By Dosing a copy on the premses on (date: .m,‘ ,0 ‘; m" ~ mu mbm‘ .. . v vu rfi a x. sk-fi m n1 v~ m...” _., u. .- Fr .., .AND gwmg a copy 1:: 2 *-ersu:~f “.2”: x... U >... . 3.. v (dam? a. ' -. V». unbflkfiu, n .-.'.. .I‘ 7.x. ,_J h (u; _ DEuuua ucccnua-x: a Iceman»: as'L. baua' webs ul uubc Ic>3 ydv 'Itut U6 dabe'idmvu UR «0) '_' I because Po person oi suuable age or discretion can be found mete t4) _ ' " dv sencmg a copy Dy man addressed to me defendant on mater n. :‘ "" (Name: was served on oehaif of an defendants wno sngned a 101m wntten lama! agreemem ' V :-.A~. v. .n .. ,. a.. I nu n ainu nauuai ac‘ mus:.._. ,u' rghce m“ file uen'czujauis .‘achgcu' m ticm: iii: dnu 5D x: mama HI Muddununi 5L d ‘ j proof of sen/zce of the nohce 0r '*-.ot.ces :n nems b'a. 6t. la. and Tn us attached to mas {orm arc Iabe‘xeo Exhabu: 1 n~,, :__‘ High-income tenant “1e 15~oay nouce m .tem 6c or 7c above [dammed defendant as a mgh-mcome :enam am,- requested subm'ssuon o! documemauon supocnrnq the tenants a:atm mat xonam rad suffered COVID- 197 rclatea hnanmal dustress Pia'mnff had moo! before serwng mat not'ce mat the tenant nas an ammai .nccme ma: 1s at least 130 percent of ihe meman Income for the ccunty me rental property :s ‘omted m and not less than 5100.000 L(Luce C": Pros . § 1179 02 5 : a i" W| The xenant dud no! deixver a accfaratuon 01 COVID-w ~'elated tmancaaa mstress wnhm the reqmreo ume :Lode (.‘xv Proc V § 1179 03m ‘ b. r . The lenam duo no! dehver documentation wuhm lhe {eaulrec nme Sa‘noponmg ma: tie xenam hat! suffered COVID-19- . . . ,. .. 1,..‘nn ,I‘,~¢ .0 w k‘ 1‘703 E '. rained ?:nanaa‘. d.stress 35 aszened .t e deaavsvw “.22 C9. . re- . a . H- “2 -12, ) w - - PLAINTIFF's MANDATORY COVER SHEET AND mm" SUPPLEMENTAL ALLEGATIONS-UNLAWFUL DETAINER _____,.~_ _____,-.__ fl ,4,“ ,_ __ V UD-101 = :LANiTEFF ilei-al'w-iaL Waikiki v: 3:37-72"? I i DEFENDANT Ctnsvre P‘acence 10 11:4 Just cause eviction. Om" applicable v!‘ aczron «s filed before Femuary 1. 2021 Note if Ine tenancy Is sumac: Io me Tenant Promotion Act o.‘ 2019 (mciuamg Cull! Code section 1946 2i plarnnfi mus! If usmg form UD- 100 complete Hem 8 on lhal form m addition Io this Item r _»_l The tenancy .a‘enmved .n (he Umawtu. dezainer comneam m tms acnon was terminated for at-fault lusl cause as defined m Cm! Code secmn 1946 2mm 5. Mm reason ;s .v the nouce of zenmnauon (Code C:v Pros . S 1179 03 Sza)(3uA)m.) b [:3 The tenancy «dentmeo m the umawtuv cetanner commaxm m m-s ac‘uon was :ermmated tor no-faun Just cause as defined m Cwui Code cec'mn 19-18 Why?) wnuw‘ rpaan r: n Hm umwp of mrmnmhnn {Coda Cm Prof: § H79 0'} SQIQHA‘MU, ; {Complete l’ 1.- or (2} beam am, I! hppn‘z anie 7 Tne nn-taun just cause :s :ne men: x0 oemonsn .Jr suusaanuaiiy remouel wmcn (,ij rs :__j vs not necessary to comply wzlh codes. statutes or regulations reeatmg to :ne hao‘tabmty of :he rema! units {Cade Civ‘ Pu)» §??73 03 5::3n3uA;-{r:, V; (2) V The tenancy :denhfed m the (,0:wplamz m thts action was ermmateo Because the owner Cl ‘ne propeny has emereu mo a comma! w" a mu, er Wm me; (Is Ia") 0x.z,upy I'm propezty and mg. unwed}. T;' does __ f does not meets ab the requremenzs o{ C-v-o Cooe secuon ”9‘46 2461181 (Code Cw Proc. §.1179 03.5(au’3wu z :(II‘: ; L2 ‘y : This acuon is based 50.6w 0° t‘ne Lause of terms'mhon cneckec rn Jem 103 or t, above. and rs no! for nonpayment of rent or other hnancua‘ ooiugauons, (ff tins don: auphes pranmh may not recover any renter deb! due from me penod between March .1 Bum and Janua/y 37 2021, as pan u! (he damages m (Ins m:nnn nCooe Cw Proc . § 1179 03 5(au'3n’BM) 11 : 3 Rent or 9.. .er .‘sn3:15:31-"b :ga :c..s due after Janquery 31. 2921. :On‘; :.~;;p..':‘°.:;.‘: t! 33::3'2 :5 fled 5:: c: '2,’.'.s- Fe... .3: r} ‘.. 2021. )Tne cmy demand tor rem or o rer hnanoa4 oblgatsons o." whxcn the unlawtus aetamer complaint m xhxs action usoasea s a demand lor Daymer‘t nf rent due after Januarv 31 2u21 12 C“; Number of paces attached wupafw Daxe -.-.._A.;.L_ Leo B Snegei ’ "rl'; ~ t»:n:‘ w"; 34.; ‘1“ u'n. mew! "sv- VERIFICATION {Use a different veufrcallon form t! the venflcahcn ts by an altomey 0: m! a Larpmanun oz pannershlp I r am me masntm .n mus proceeoung anc nave read Ins comolaxm I aecaare unaer aenaay o: pergury uncer me laws of :ne Slam m Cauforma tk‘al the lorego ng '5 true and correc: Dam Januaryfim 2021 Lec 8. Ssegel. Axtomey Yo: Ffiamufl see attached venfacauon b Hug m "-(Ni 5.x, ; .‘an ‘-. we.» c; -.. .w: .2. ; r PLAINTIFF‘S MANDATORY COVER SHEET AND 4°“ SUPPLEMENTAL ALLEGATIONS---UNLAWFUL DETAINER IJ ’4: S'!I\!‘lz()l'(‘.-\l {H){Mk t t w. {‘(H’NI‘Y U} SAN E .\ ('13ka ) l. lhc uiidcrsigncd. L‘criié‘} and deduct iii.“ 3 ham imu’ the iivuguingl om} I 'D-HH and km.“ iih umicnb. “u: siu‘LuncI‘xi ihlimxing in lily {ms Lhukud lk‘iu‘n i> amviiLuHc. i i ium u pau'i} ‘w thihuctiun. ihu mu‘ucls ain'tul in ihcducunwnl dcm‘libcd almxc mu lluc ul'm} mm kmm icdgu und bciicik‘xccpl ua m thc nmllurs snucd un iuilu‘nuuiun and hchcf. umi us In lhmc nunlcrs i bciicx c lhcm 1n hc lruc. | i i am l i Lm m‘l'wcr i i a peu‘mcr I i u ui' u purl} m Hm action. and um utllhnri/cd m mukc lhis \ criticaliun mr and nn il.» hchall'. and i mum this \criliculiun fur lhul rcumn. i um imhrmcd und hciicn: and on that ground ullcgc mu! inc muucr) slated in Ihc dncumcm dcwnhcd uhmc arc lruc. i I I um u Proper!) \lunugur and nr .-\gcm I'm‘ the Huimifl in Ihis‘ action. and l um making [hi5 \ criticuuun 0n hchuH ul‘lhc l‘lumuH. m lhul. l pcrmnull) manage mu prumiws “hich m'c lhc subject ul [his action. um! hum.- pcrwnul knuulcdgc ul lhu Inch alleged in Ihc attached L umplaunl. |.\ | Ium lhc ullumc}. ur nnc ul 1m: ullurnqs lnr l'lmmil'l‘. Muhammad \ltulul'u . u purl} m this uclmn. \I) chum Ls uhscm Irum mu cmlnl} \xhcrc l ur mch uuumcp haw our uHicc and Is unublc 1n \ cm} lhc ducumcm ducrihcd uhm c. l'ur Ihul rcawn. l um making mm \ crlllcaumn for and on hchull‘ul'lhal pun): I um imhrmcd und bclim u 11nd on lhmc gruunds ullcgc [ha] lhc muncrs slulcd in xuid ducmncm urc lruc. I \cculcd un .lgmuun 2!. SHZI . m \\ ulwmlllc .("uiil'nrmLL l dcrlurc under pcnull) nl'pcxfiiur} under Ihc izuu ul'lhc Slulc ul‘(‘;|limrniu [lull lhc lirrcguing is H‘uc amicurrccl. . f ,. . ‘ __ [Cu B. Sicgcl CP10.5 NOTICE: EVERYONE WHO LIVES IN THIS RENTAL UNIT MAY BE EVICTED BY COURT ORDER. READ THIS FORM IF YOU LIVE HERE AND IF YOUR NAME IS NOT 0N THE ATTACHED SUMMONS AND COMPLAINT. 1. M you live here and you do not complete and submit this form, you may be evided without further hearing by the court along with the persons named in the Summons and Complaint 2. You must me thus form wnhm 1U days of the date ot servxce listed m the box on the nght hand Stde ot this torm. o Exception: If you are a tenant being evicted after your landlord lost the property to foreciosure. the 10-day deadine does not appiy iu yuu and yuu may Hie filis I'uuu ai any lime bcfuu: judgmeui is enieleu'. . If you fiIe this form your cIaim will be determined in the eviction action against the persons named in the complaint. ‘ lfycu dc pct file thus ‘Crm \Ircn may”ho nuGMnd \I’thnf funhnr beefing .hw 5. If you are a tenant being evicted due to fozedosure you have addiuonal righs and should seek legal advice immediately. m_nlrgnru‘r op m_qnnum qwgougv mom gag Aypggx- -r. .-~. A. ... .. . - M... m»... w. MCMTLSEMLY n? ?ORNE'I FUR murme NAME 0F COURT: SUPERIOR COURT ()F CALIFORNIA. COUNTY OF SANTA CLARA STREET ADDRESS 191 N. r lrst 5t. WUNG ADDRESS 191 N. First St. U“ ““"WWE San Jose 951 [5 BRANCH NAhE Plaintifli MOHAMMAD MUSTAFA Defendant: CHRISTINF Pl A(‘FNC‘IA: et a] PREJUDGMENT CLAIM OF RIGHT TO POSSESSION ms; "um“. ‘V 7 Complete this form only if ALL of these statements are true: 2 I C 3 5631 1. You are NOT named in the accompanying Summons and Complaint. (To be completed by the process server} 2. You occupied me subject premises on or before the date the unlawful DATE 0F SERVICE deminer (eviction) compiaint was fiied. (The date is in the accompanying (Date mat form is served or dammed, Summons and Complaint. ) posted. and mailed by the officer or 3. Ycu 3:33! occupy the subjec: 7.3.7.5333. process salve!) ! DECLARE THE FOLLOWWG UNDER PENALTY OF PERJL'RY: My name is (specify): 2. I resMe at (street address, unit no., any and ZIP code): 3. The address of 'the premises“ subjed to this claim is (address): 4. On (insert date): . the landlord or the landlord‘s author'aed agent filed a complaint to recover possession of me premises. {This date is in Me accompanying Summons and Complaint.) 5. I occupied the premises on the date the complaint was filed (the date in item 4). I have continued to occupy the premises ever since. 6. l was at least 18 years of age on the da eoothe complaint was filed (me date in item 4)‘ 7. 2 ciaém c right :c pc“""ss:cn of tn: p:3:?uses because 3 smpmd the premises an the dat: tn: amplain: was fikzd (ms data in Pam 4). 8. i was I'lui named Eli {he Suliu’nm‘ls arid C0i‘l'up‘allui‘ 9. l understand that if I make this claim of possession. I will be added as a defendam to me unlawful delainer (eviction) action. 10. (Filing fee) I understand thatl must go ‘0 the court and pay a filing fee of S or file with the court an ”Application for Waiver of Court Fees and Costs.“ I understand that if I don't pay the filing fee or file the form for waiver of court iems. i wiii noi be endiied i0 make a ciaim oi right i0 possession. (Continued on revase) c: ass“... J... :5. 25:3; FREJUBGfiEfiT CLAIM; 0;: ~55HT mac»: ammgguua. 715.010‘ 715,020. 117425 TO POSSESSION [.m'ufmm K .1'mulmuedt 'm'yin'mo jua'mui ('uum'ii Forum CP10.5 Plaintifi. MOHAMMAD MUSTAFA “55W“ flu. A nu. .wsgnda..:. cumsrmg pLAczwch 2:CV375531 11. If my landlord lost this property to foreclosure, l understand that I can file this form at any time before judgment is entered. and than have additional rights and should seek legal advice. infler I file this12 ! t_lpdgmtand mm Q \uifl have fill: dang lnfiduding snuff hnl'w‘au:\ On fiie a r panse 0.9 t_h" Summens and Ccmpgajp _.--, -, .- Prejudgment Claim of Right to Possession form. NOTICE: If you fail to file this claim, you may be evided without further hearing. 13- Renal agreement. I have (check all that apply to you): a. L_J an oral or wn'nen rental agreement with the landlord. b. F-l an oral or written renta! agreement with a person other than the landlord. c. E an oral or written remat agreement with me former owner who Iost the pmperty to foreclosure. d. L: uiilea (explain), l declare under penalty of perjury under the laws of the State of California that the foregoing is true and correct. Date: (TYPE OR PRINTNM) (SIGNATURE 0F CIAlMANT) NOTICE: lf you file this claim to possession. the unlawful deta'mer action against you will be determined at trial. At trial, you may be found Hable for rent. costs. and. in some cases. treble damages. g -- NOTICE TO OCCUPANTS -- YOU MUST ACT AT ONCE if all the following are true: 1. You are NOT named in the accomnanyinq Summons and CompIaint. 2. You occupied the premises on or before the date me unlawful detainer (eviction) complain! was filed. 3. You still occupy the premises. You can complete and SUBMIT THIS CLAIM FORM WITHIN 10 DAYS from the date of service (on the form) at the court where the unlawful detainer (eviction) wmplaint was filed. If you are a tenant and your landlord lost the propefly you occupy through foreclosure. this 10-day deadline does not app|y to you. You may file this form at any time before iudgment is entered. You should seek legal advice immediately. If you do not complete and submit this form (and pay a filing fee m file a fee waiver form if you cannot pay the fee). YOU WILL BE EVICTED A99!- Mn:- farm us nrcperh: filed no“ n_nl| bu addnd ae a flo‘andon. In me unlawful dnioiner lnuihfiiorfl enfinn 5nd umw rink. On9-,. ,, "nu“. u, «vuv..\...u ,va- ”v... .u“nu... «you .uu occupy the premises wit! be decided by the court. If you do not file this claim, you may be evicted without a hearing. cmas (Rev.m ‘5. 20x3 PREJUDGMENT CLAIM OF RIGHT T0 POSSESSION ”9"“ Lamfi’um R dmammcd I. ‘uhfiu'm'u Judicial (‘mmrilanm ©WQQM§WN~ M “Naarup-tb-t-t-Ih-v-mv-I 3g8585~O©MQaM&wN-O Christine Placencia 3277 S White Rd #272 San Jose , CA, 95148 ‘fNCI’ZRSEED Defendants, InPro Per F JUL l 3 2021 .Clerk of the Courtmmmdmmumm 3V EPUTY SUPERIORCOURT STATE OF CALIFORNIA, COUNTY OF SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMITED MOHAMMAD MUSTAFA, N0. 2!CV375631 Plaintifis, ANSWERAND REQUEST FOR JURY vs. TRIAL [CCP 117]] CHRISTINE PLACBNCIA; and DOES l to 6, Inclmivc, Defmdants. DEFENDANT HEREBYANSWERS THE COMPLAmT AS FOLIDWS: Defendant denim the allegations in Comlaint parag'aphs l, 2, 3, 7, 8, 9. DEFENDANT HEREBY DEMANDS A JURY TRIAL UNDER; 5 DAYS ESTIMATED.W Scrviccofthcaflcgodnofioewasimpropainthatthmwasmattmtatpersoml servicepfiortotheuseofmbstimtedsafioc [TheBankofNew York Mellon v.Prccindo (2014) 224CaLApp.4flISupp. 1,6],andmbsfimtedservicewasmaeforenotmflmized. Hmm IheauegedMynoficcisnotflwmcrequimdbyCodeofCivilewfine§1161(2)m havebeenservedinthatitdownotg've3cmmdaysmmmonly3ealendardaygapplying CivilCodc 63511. film m Plaintifi',inhisconmlaint,hasfiiledtoallegeoomplianoewi&€ivil€ode§§2924etseq. ThebankwasnfiwasndpmteaedbymedeclmafimofmcsclfingmmmdchivflCodc §2924.mmmmismtptmwedbythcdcchmfionsoftheseumgmfhmffis mquiredmauageumuwmquhedmficawmsmedmmemmphimitscmAmiewof m4ofmcomphintwillmalmmeaflepfiommm FumAmmngm ' Plaimifi‘reoeivedadefexmlofhis fdsmllybackedmgeandismaefucmedfim hum' anymctlon' ' achon' mhtedtothesubject' pmpa'ty. WOOQOSthN u-‘h-th-h-u-u-n MhWN-IG WHEREFOREDEFENDANTPRAYS: I.WPlainfifi‘mkenothingbyflfisacfion ZForadcuecofrmcissionofmelmseandmfimfimofaflmoncypaidelamfifl' 3.ForaCCP ll742dderminationanddecmeteducingrentuntilhabiubifityismed uhdhdb-i Oflda 4. Forammeyfeesmix v- Tmmnjan] andcmntoosts- 58 DATED: July l3, 2021 I l, MW; Placmcia Defendant. 1n Pro Per N Ba’i‘a’fiufi WWHONMAUJN- ~h‘ HH- Eggeaosamth-ZE 24 25 26 VERIFICATION STATEOFCALIFORNIA, COUNTY 0F SANTACLARA Iamapmtymmisacdmhvereadflchmgoinganddecmmpanflyofpajmy undetfllelawsofthesweofCalifomiathatthcforegomgismnaMmrecL Executedonluly 13,2021,atSanJose,Califomia. PROOF0F SERVICE BY MAIL STATE OF CALIFORNIA, COUNTY 0F RIVERSIDE lam embyedintthounty ofRivetside, CaliforniaatPOBox 2417, Idyflwild, CA 92549. IamoverflxeageoflSandnotapmtytofllewifllinacfion. OnJulyl3, 2021, IservedflreAnswcronthe opposmgpartflsfinmisacfionbyplacinga true copyflneteofenclosedinasealedenvelopewimmgcmcreonfilflyfullypmpaidinmcUnited StammaiIatldyllwild,Califmnia,addremedtoz Leo Siege] 1726 Seabrign Ave Santa Cruz, CA. 95062 ldechreunderpemltyofpujmyundcrthelawsofmcSmmpralifaniaflmflneahove istmeandcormctExecutedonme l3, 2021 atldyllwild,California SUPERIOR COURT OF CALIFORNIA COUNTY OF SANTA CLARA MINUTE ORDER Mohammad Mustafa vs Christine Placencia Hearing Start Time: 9:00 AM 21CV375631 Hearing Type: Trial: Unlawful Detainer Date of Hearing: 09/03/2021 . Comments: Heard By: Overton, Carol Location: Department 11 Courtroom Reporter. Recording Electronic Courtroom Clerk: Jenniffer Morriss Court interpreter: Court Investigator: Parties Present: Future HeariQE: Mustafa, Mohammad Plaintiff Siegel, leo B Attorney ER start: 9:313m. Matter is mfled on the record at 9:313m. Attorney Leo Siegel is present for and with PIaintiff. There has been no appearance by Defendant. Plaintiff's Exhibits are marked: Plaintiffs 1: Notice of Tria! Date Maintiff's 2: Grant Deed PIaintiff’s 3: Notice to Quit Plaintiff's 4: Proof of Service Plaintiff‘s S: Trustee's Deed Upon Sale Plaintiff is sworn by the clerk. Mr. Siegel proceeds by offer of proof. Plaintiff's Exhibits 1 thru 5 are ADMITTED. Ptaintiff has met his burden of ptoof. Judgment in favor of Plaintiff: $645 in costs plus $31,065.89 in holdover damages, for a total judgment of $31,710.89. The court signs the proposed judgment and returns it to counsel for filing. Exhibis are released back to counsel as well. ER end: 9:57am. Prim: 9I3/2021 MIGROZI TIH:UM Definer -21mm! M ld 1 [10-110Amaml’mmflmm“Mmllm ”Mum? LeoB. Sicgcl, Esq. (Staten.Bar 116841) ‘STONE- SIEGEL LAW FIRM 726 Seabri tAve.62 Santa Cruz, A 9506 mn(83l)768-9110 wrow(83l)7l3-S797em M leob@legalsi cl.org ILmomamnmPlainufi‘. MO AMMAD MUSTAFA mmcoumwffirfiégfistegworSANTA CLARA 35p 0 3 2021WWW I91 N. First St.mmmmSan Jose 951 13Mme MWFFI MOHAMMAD MUSTAFA DEFEDANT: CHRISTINE PLACENCIA JUDGIIENT-UNLAWFUL DETAINERD aycnerk E m n E mercounmalm BVCoun E gzssesgon Only m Defendantmdm 21CV375631 Appearan’rifl JUDGMENT 1. E BVDEFAULT a. Ddetldaruwasptopadysewedwflmcopyofthesumsandcormlah. b. Nmmnmrthemcrappearmddefendtheacfionwammet'meaflowedbth. c. Delendanfsdefadtwaserfleredbythecletkmmplaimiffsappflcam d.D Clerk‘s Judgment (Code Civ. Proc.. § 11.). For possession only of lieum desuized on pagez (nan 4). e. m Com Judgment (Code cw. Pm. s 535m». The cam madam (”D plainmrstaunonyam otheremence. (ma puainmrs or others written decimation and evidence (Code Civ. Proc.. § 585m). a m unmooummw. Thejurywaswm'ved. moanmssdmdmevideme. a Themsewasuiedon(mwmue):8cptember3,2021 beoore (nameamong;- Hon. Carol Overton b. Appearmces by:m Pia'nifl (me eaM): m W3 3110mm (mme eadr): Mohammad Mustnfa (1) Leo B. Siege] (2) D Continued on Attadmum (Iona Moms). mmmmeadz); D Wsaflmeyflwmeacm: Christine Placcncia (1) (2) D Comiwodethd-mZbaonnMC-QS). c. E Detendamdtdnotappearatuid. Delendmfimpropeflyservedwflnofioeolm. a m Amadmmwouecu.m..§6&) m wasnot Bras requested __ W3 Mohm‘nmad Mustafa usenuuaat DEFENDANT: Christine Placencia 21CV375531 Juneauns ENTEREDASFOLLows av: m mzcoum D WECLEBK 3. Parties. Judgment is a m for phimin (name each): Mohammad Mustafa and agains‘ defendau (lame adv: Christine PlacenciaE Continued on Anadmaa (tam M0435). b. D tor defendant (name each).- 4. m mm D 0.1mm hmmmdmmmm (mmmmmmmwxwmm): 3652 Slopeview Dr., San Jose, CA 95148 (Santa Clam County) 5. E Judgmmappiesloanoocmantsofmepmnises induingtenants. smtenantsifanymndnameddeimansifanymodecw. Pmc.. §§ 715.010. 1169. am 1174.3). 6- Amounundmofiudmwm a. DwmmnanedmwemaaabovemmyphMo-am b. Emsmrmnuhmmwenm comm”: mnedinMSb. i (1) E mmmn s D :gflgflwnetinmwstomr ‘2’ m Hotdoverdamges s 31,065,891 mandamus“ s (3) D Anomeytees s (4) m Costs s ’eVS. oo (5) E overspend».- s (e) rmumem s 311mm“ c. D Therenialagreemem‘smmebd. Emulaase'smned. 7 DWW PwmmdmeagmmmmmmmmassmwnWWWW¢mumnommam .. aE M(spedy): DWmAm-msmuooes). Date; m 'fl J‘9'3“ol°3" V JWiOvertonm D Clemw -m m CLERK'SCERTHCATE(OpfionaI) lwfiymm'aisatmeoopyofmodgnaljudgnaumfilahmwun. Date: Gemby .DBM ©WQGM§UN~ ~ H gggggmng’GESaGZuETJ's _ Dons emm- pm- F L3277 SWhimeRd #272 SanJose,CA,95148 SEP 0 9 REM) Defendmlnl’ml’cr aOkaftheCourtWmmafimgzrw SUPRIORCOURT STATE OF CALIFORNIA, COUNTY 0F SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMITED MOHAMMAD MUSTAFA, NO. 21CV375631 Plainfim, NOTICE 0F MOTION AND MOTION FOR vs. NEW TRIAL; MEMORANDUM 0F POINTS AND AUTHORITIES; DECLARATION 0F CHRISTINE PLASCENCIA; andDOES l to CHRISTINE PLACENCIA 6, Inchfive, DATE: TBD Dcfanhxs. TIME: TBD DEPT: TBD T0 PLAINTIFF, COUNSELAND THE HONORABLE COURT: NOTICEIS HEREBYGWENthatmfitdatemdfixmmpfimedabovginthcabove- cnfiflcdomncDefuxhnthtmdstomoveforancwuiaLongmwmdsthat: l. hmgulafityindlemowdingofthemjmyoradvasepany,oranyonb‘offln wmtorabuseofdismaimbywhicheiMpaHywaspmvmwdfiomhav'mgafiirhial. ZAccidmtmsnprisqwmmordhmypmdcnocmddnothavcgzmdedagam B.En'orinlaw,occmfinga1flleuialmdexoquedtobymepmtymkingdnexpplimfion. Thismfimisbuedmthcfoflowingpohlsandmmmchafionof Chrifl'chlasceucia. WFORNEWTRIAL p... OWQQMbUN “unbu-u-A-t-an-u-nn-s BOWNOM¥WNH¢ 21 DeWIanPu MEMORANDUMOFPOINTSANDAUTHORITMWm CodechivflPmoedne§656etseqpmvklefmthknmfimThcnofioeofhfianionm movefornewuialishacwhhfiledandpmpedymedwithfix IS daysoffllemtioeofenlryof MgumLCodeofCivilecedmwa Amofionmnewuinlmnbebaseduponammofcminchldingz Lhnguladtyinihcpmeedingsofmecungjuryoradvasepanxmmyorduofthe mtunhmeofdiscrdimbywhichciflnpanywasptcvcntedfivmhavinga fiirhial. lAwfiunmwpdsgwhichotdimrypmdemecmldmthavegwdedaginsL 3.anhnlaw,oocmfingatflnuialmdexoeptedmbyflwpanymkingmeappficnSm mlawissetaedmealifmniamatauialommhasmunaddisuefimmmmgma Mmfmmwflialashmymweighmccvidmmfiisbcficvcwimmflaaasamhmm jumr. AnaderyanfingnncwuiflWnotbedisturbedmlmamanifwandmmhbh abuseofdisaefimclwiyappmmflisispmfiaflaflymwhmmedimisexudsedm favorofawadinganewuial,forfilisacfiondoesnotfimllydiswseofmenmer.Solongasa mmblemwmfafiydebamblejmfifimflonumflnhwisshownfmmcmdaglmfingme newtriaLtheordawillnotbesctaside." Bellv. BmwrischeMomr-en WerkeAhiengaellschQT, (2010) 181 Cal. Am-41h 1108, “22 (cifingJimMV.W,M&Ca (1971)4Cal.3d 379,387.) mmmmmitshmddisaefimmdmdfisnnflmfmamwufldmm dwfictflmnefmmwasmmficedofmeuialm.0efmdanmmemfmemmmted fimnbcmgmuflmufilafl(ifitwcmed)mflwmmisqninmssafiflanpfise Defaldanthasaflzmdmatnemdconectumyofmemg'stfioffimfirmis meWSJGZLhiLthereismmomdomeqmgmsctmfl. Themisnomcosdofmcoomtmflinganoficeofuialdate.’l‘hacis,howeva,rmdof Dcfmdmfi’sAmwuwhichdummbaJURYTRIAL!flmeisakomcmdof&eddfimlfee waiverwhichwafldhavewaivedmejmyfeedeposigspecifiully. IhemhnnnmtktofthepmponeduialhsmEthIlanoficeofuialMe-Thucism MWMngmdmsewedupmdefendmtAddifimflly,fiismtinmemdas filed! Defmdmthdnomfiocofflnsmposedtfiiaswhsmdouhthephnforminfifi’s counsel. mmmmyofmmmmmmmmywmmgmm Plainfifi’scumselmhqnheasmflzeposmhflhyofflx'sprwahnflm.fiedicubly,me Plainfifi’sommsclrcfisedtorspond. NotonlyisflfisblamntpajmysubmnedbyPlahIfifi’smmseLitisaviolafionofflw RNmomefeNmalCmMmflPlainfifi’smmselshmflberepfinmdedmdmfumdmflm barfmdiscipfinefmwasfingflncwmt’sfinnmdundenniningflmdigfityofflneoomt ©00fl¢hh¥w~rd NH-Mflflh-wv-flGONNOMfiWN-nfi 21 Respectfullymbnfifled, 0/3” DefenhntIanPet MOTIONFORNEWTRIAL -3- WNQONUI&MNu-t I-nu-nuflu-ku-su 0MQO‘M“NN~¢ 20 W STATEOF CALIFORNIA, COUNTYOFSANTACLARA, LGnistinePlaomciaJtam: Imflnchfaflaminflfisacfionmdmkethisdechafionofmyownpum knowledge. IbmawueflmtatialowmedeqtanbaiZOZthdmmofflfisuhlnor didlmceiveareqlmmsdhialfioml’lainfifi‘. Ihaveaflachedammandomrectcwyofmckeg’suofacfimsinfllismmImbmhmd fiomdneclak’soficemSepeanba&2021,asExhibitA.Thissbowsflntflleommhadno filedreqwmsatriaLMnonoficeofn'ialdatc. mbsafisuyofmfingmfiadukmmbavoidsmfinyofmeirchhn ThePhinfifi‘hinselfomeshowedupmmyraidmwfihamWchkdemmwmy mmmlvmmepmnim. SimefifingmyAnswadeckedfiereg‘fietoffionsdaflybygoingtowmtand mfiingwasevamfiemg‘stawifluegardbfichidlhavcidmhowitwnldhavebem scheduled. IhndmyadvisingommseltytoconmaPhinfifi’somdandrwolvethcmbut Plainfifl’somnsdrcfimedmlwpond. lwasptcvmmdfimnafiiruialmwmhegulmityinbeingpmvamdfiunwing atmytrial.Ihavcavaliddcfmsesmmcmwcrandhawbemvigomuslydcfendingthiscase. Sinceequflyabhotskfanm,lnkfllatfllecomtallowmcafairuialtodefmdmymse.Iask thattheomutvmtckomnttrhlthatowunedSeptanbalZOZI andrwaflnemauerforjmy uial. [declarenndapunltyofpajurymfllelawsoftheSMeofCafifiu'nMflne foregoingisuueandomea. MOTIONFDRNEWTRIAL -4- EXECUTE)TH]S9"DAYOFSHI'EMBER,2021 ATSANJOSECALIFORNIA. PROOF0F SERVICE BY MAILANDEMAIL STATEOF CALIFORNIA. COUNTY OF RIVERSIDE Iamemplo inflneComtyofRiversik,CalifomiaatPOBox24l7, Idyllwild,CA 92549. Iamovu cageoflSandnotapanymdncmmmactim. mOnSeptcmber9 2021, lsavedflneMofionforNewTrialonflneopposingWsfinflfis placingamnoopy flmeofenclosedinasealedenvelwewflhposlngcdmemfnfly plqnndhlfiernfiedSmsymflatldyanCafifmmkhmsedm: Leo Siegel I726 Seabn‘ght AveSm Cruz. CA. 95062 by cnmil to: |cob@|e@lsiegel.org IdecheundapanltyofpeljmylmdumelawsofflneSmtcofCafifom'ndntheabove istmcmdcouectfixeanedonSqnanha9, 2021 atldyllwild,Califomia Ken Wmmm CD]. REGISTER 0F ACTIONS CASE N0. 21CV375631“Macaw“ Q Mom Ova 5 Judicfl omen: Johan. Eli S g Filed mu unmet Cas: lxmuunos memes _ wumw21mm (w) Cue Type» [5-H (n)- ..dn luauzmmozm (w) swam. ommm m-cmncmm Cacw FeeWaivaw DUI Cassmuster CmCueWm Cam Rumba ZlCV37563! Conn Civfl Du: As’gncd (“Ml Judic‘d Oflica 1mm Erik S PAKIT “MMTI‘N (Aduamm m.MIR.“ m lg. IW uI-nJ-smmM Mm m Se DATE Evrxls & 01am orm: corn hm 01M! EWWM-UMMU Fot: Ph'm’fl‘ W 01/251202! Emuum10mm“ UpmnoKcw-owbaam Fa:WWW 0M] aw UD 101 Fa:w Mm.W mm: Ecmcncmsm Cm‘lCanCmflner For.WWW mm: gunman: 0129:2021 Emmm 0109M! Emmw Pm [G 7 M-flwmld [2:59 P54 OIMI Wlml MINI WWIZOZI 02117002l MIMI MW! 023412021 Oliml 03103002! Wlwfl 0312-9202 I WWI MIOIWl Mlflfll m1 Clfll. REGISTER 0F ACHONs CASE N0. 21CV375631 Evomw EMWW REMWa-melafiammhmbwibgwdumy ngobyllzmmlh-uionflmu'sum' For. DamWW Emmom 02:74.32! @9:I§ainDl:$aviadSm FauPidBy:m PhcumChm E motorsmog:Sm Du: (Chin M45611}:dmcm For. ma Mummm EMWMW For: Dem M Em wmada-Dmy DEVIEDbyJ-Qe0mm" Fat:m Pheamia.Chm Qumommsm (IMOMJMMS) mdmbyMChMmPWIinmmi Emudu .FmWivqufimim-Subm For: Defm marsh: Ere: WaiverwhimGumaww-0mm For. Dem Phcat'u. Chink: go .. lm. .FmWMMW Emm(mm (mommchnmm-LW) Emmott: EonsMWwMBDENlEDMMMkaWW§MA mmmfivkme-H-zlai-MAM'DIM.IZMMWIEWS 6155427} Fa:WWWW EmWWDW:MMMMWMCW Fm:PWMW 04W! WI WI 04W! Ofiml m1 0411M! WNW] WHIMI 0411an WI Cum. REGISIER 0F AmONs cAs: Na zncvsvssslEm Nahdmgdramfir Writ (slaymw. byPmhpcpa. [ZIJPwZflG] For. Dew Hamil Ckfine 3Marsmcc Saunas Duz (Civil) for.mammal! Emuw Fa:Mfl'mm Emma: [21 2716] For: DemMW a PmofofSavie: SanusDuuCifil)Wdhu‘admfw Fm:WMW EWMM Pml'mdlmminmfirbflz; Pkwmmucafl-mudm inimnillc). ProddSenicefikde8’2021isWaLhafi'um Fm: PWMW Bmmm NomalafwdlMoL-cm WlOfikdoIH-EZDZIBhbmfim fimrmmmummw(mommwm mper 03-2421 Mo Emma Emma“MM mwm "Samraiu-zl awruhimsmwhmody.MWflaw .kbpa-alafi-dlmm For: PmMW Eons“ ‘a-da. Nomadtosadéedryq’Wfiu 452%]Wwfir B'n‘rj m.fiflqnnBWm-tfimll. l.Q 4'2 2021.WCWWfldcfibfiaJM‘JM MIMI MIMI WI WI 0m} WM! MW! WI m2! WWI 0409M! CIVIL REGISTER 0F Acmms CASE No. 21CV37563] Prtunlian4W! (Attached, 25:45-20)! theclerkemmdkzqwtfa’Em-t q’DefiakWDefiduCh-m‘m l’ nan. 3 waitrfiuybgPaia’mfirWfirdzlmadftwfloyJTfide PrmdmgvasmaH-xaoy. Ink:ququmythWeflutSZOflma-MithaSWP a Proofof Sav'u: Sunnom DLR (Civil) WdSeNiceJW’CWNJUMlansim For.WEM Emmfinmad “SuMI’aS-ll-Zl Oder” For. PmMW QlwMum "fit .‘m'tb Per 5-! l-ZIW' 3652SW Drive, SanJm. C4 95:48 For:WMAWW Dcfcnm m Nm'oe AllUmdm mmmmmm‘nM(WWWWMIUWW) Unlawfinflkla'ncr AumidTo:MMMWmedmmmz Slopcviru- D-ichnJoscCAfiusAmmmufimnc Tm]: Slim Edutkq’caionLmWkMmm #14702! d+5203L Fa: 0cmWW EMMSQM’Vm kg. 0429-2! {1‘}!th FestBy‘. Demmm ED .l. .m. _ EszAppliam‘a fifixmwEIMW’fl‘qu-MIM Fm: Dew thCkism: QWEXPUE WMJBPanmmmmmsq‘mflWfiwWwN/QQH @9:ljm7-DJQ'WM FmMWW EmasmxmdedWmtoExPnawmfafiqthfiww Fm".mM WI WI WI WI WI Wlml Wlomfl Wlml WIN] OSIlml Wlml MIMI WWI m1 CM]. REGISIER 0F Amons CASE N0. 2]CV37553]Emqumsnn(mommwg wamyadWfimWIMWMZGZI orb) Emmott QEMW EwatzAmfi-mahM’MmhMinm“ Foc Defam E0 .. ‘0'. . mmuwWIBPwWawfiaLfl-MI Fol: PWMWEmWmd‘koflkgelmeExMWmmfi-Mwfl-Ja 20.?! For:m5MW Writ:hmasmed) “chko Par 5-1 1-21 Orv" 3652WDink“ CA 9518 Fed Pa‘d By:WMMama Em Mui-mem (mommuzmi-mm)fumuwfin-W1 Imperm'nzl Mo;“haw EmmwmmmmmmmmoomM) For. mm EmmMfiledalmjmwmm amormmhm Emma: EmmMstMmwwwm for mrhccuckclm gameMm using- ms HgS/IflflMWWWWWGRM’GMSdMmumfirwfiumTurmde’ Fm PlaintiffMmmind Emu medméMrammd'ps a- ab 07082! @l.23% m DIZ Fashion}:0mMW EwmrmmmM907LW WI WWI 07W] WIIMI Mllml MIRIMI WWI MIMI WI WI WWI WM! CM]. REGISTER 0F Acmms cAs: Na zncvzvssslEmmmamREWMWloCWfirCMDHW Emanmuaomy (Jusficiuommhvui-suw)mhcmbndmrmmmw) Emcee QWMl-hfl (aCam hv& For:m Munch. Chhim chch‘mAppfidnnNWAWFm Fa:mmam: Qmwmomraummmrea GMWEDQI‘WOIHM For. [kmWW EonsMWBWMMmmdfileflmmhvaIF‘a-ufi)”@Cmm' Emma BJSICamJllUMWOA’LY.A'OTE‘UHEDammW PbcaciammAu-trmfidm 1’113021. Fa:MEMMW Again Debbimm Nukemumm 3mm:mm For:WWW eruu-hwnmmmmumommaon Elma!WWO; Sme.CA ”Ha $31.?lfl89 For.MMW Emma erPbacn‘o-(Ianod)mlgw u.hm. CA. 95148 Dan HSASCIAL IXFORMAWS TonlChm TomqunnuflsuflCmd’uMWaJMIMI”MW 3|8.l$ 3l8.15 0V1]. REGISTER 0F Amous CASE N0. 21CV37563] Ionian“1‘08deMkafiml M70 3‘8.” _ \OOOQGthUJN NNH-mflwfl-HH-n Bh-meflamthn-O smswmkdmn . SanJose,CA, 95148 35F 0 9 REED Dem 1nPm Pa "MGM”“game... APPELLATE DIVISION 0F THE SUPHIORCOURT STATE 0F CALIFORNIA, COUNTY OF SANTA CLARA Qustinel’hoan’a, N0. 21AP002721 I en.n-umi vs. NOTICE OF INTENTT0MOVEFORNEW TRIAL SthmConntySwaiorCmmRmWM lePanyinlnm Notice oflzncnt: NUHCEISPIEREBYGNENMDcWMwmwfwanfiangm‘mds that: LIneguhfityinfllcpmowdingsofmcmjmymadvasepmtfimmyordemfme Mmabuseofdimbywfichédmmywasmanedfiomhafingafakml ZAmidanmanmwhichmdimrypmdcncecouldnotMVeguardedminst 3.Eminlaw,ocumingatflefiialandexwpmdtobyflnepmtymhngmeappficafiom mum \DOOQ@W¥UN~ pt)..- t-‘° DefuflamJanPa PROOF 0F SERVICE BYMAILANDEMAIL STATE OF CALIFORNIA, COUNTY OF RIVERSIDE lmmmhyedhflnCmmtyothasidgCafifmniaatPOBonflZWCA 92549.1amovu'meageof182ndnotapartymmewiflxinacfion. OnSwtanbcr9,2021,Isa'vedmeNofiwof1ntexnonmeopposingputy(s)inthis achonplacmgbyplacmgamnoopythemofencloscdinasmledcnvelopcwithpoaageflneonfufly prepaidmflnUnimdShmmflatldyllwfliCafiibrnigaddrwsedto: Leo Siegel I726 Seekight Ave Sanm Cum, CA. 95062 by mail to: lmb@lcgalsiegel.org IdecheundapmaltyofpajmyunhmelawsoftheStatepralifomiaflmflnabove isuucandcotmctExcamdeqfiurba9, 2021 atldyllmuCahfmnia WWW! -2- F. I i ! ©00fl0‘UIAWN -r-nu--v-nu-AH-H WNQM¥WN-o 21 é Christine Placencia a 3277 s White Rd #272 San Jose , CA, 95148 Defendants, In Pro Per SUPERIOR COURT STATE OF CALIFORNIA, COUNTY OF SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMITED § MOHAMMAD MUSTAFA, Plaintiffs, i vs. f CHRISTINE PLACENCIA; and DOES 1 to 6, ‘ Inclusive, Defendants. To THE HONORABLE COURT: NO. 2 lCV37563l EX PARTE APPLICATION FOR STAY OF EXECUTION AND SHORTENTNG TIME FOR HEARING; MEMORANDUM OF POINTS AND AUTHORITIES; DECLARATION OF CHRISTNE PLASCENCIA DATE: September 10, 2021 TIME: 9:30 AM DEPT: 11 DEFENDANT HEREBY APPLIES EX PARTE for an order staying execution on the grounds that the matter is entitled t0 priority. a writ 0f possession pending hearing on the motion for new trial, on grounds that Defendant would otherwise sufiet inepamble harm, and to shorten time for healing on the motion for new trial, on This application is based upon the following points and authorities, declaratiou of Ex Pam Application H NNNNfl-h-n-u-‘u-AHH-H “NFOCWNO‘MAWNWO NNNN”Nam DATED: September 9, 2021 /s/ WWQO'NUIAUJN NA ‘ Christine Plascencia Defendant, In Pro Per MO DUM 0 TS AN 0 S ‘ l. Ex parte application is proper The Court has inherent power to stay execution. Code of Civil Procedure §918. The Court ‘ also has the authority to shorten time for hearings. Code of Civil Procedure §1005. Ex pane ‘ application is proper where notice thereof has been given by 10 AM of the preceding day and that ex pane relief is necessary to avoid irreparable harm. California Rules of Court, Rule 379. California Rules of Court, Rule 3. 1203 (b) states, “A party seeking an ex parte order in an unlawful detainer proceeding may provide shorter notice than required under (a) provided that the notice given is reasonable.” Notice to vacate has been served in this matter on September 9, 202 l . Lockout is 3 imminent. Defendant requests that the writ ofpossession in this matter be quashed and recalled, on 1 grounds that without such a stay, Defendant will be irrepambly harmed, being deprived of her 1 day in court and being evicted, despite the iITegulan'ty that prevented her fiom a fair m'al by Plaintiff and the procedural errors at the clerks ofi'lce in failing to require a request to set trial i nor noticing all parties of the trial set. Proper shortened notice of the ex pane application was given, as shown in the attached ‘ declaration. Ex Parte Application -2- H ; Respectfully submitted, /s/ 1 Christine Placencia, i Defendant In Pro Per j CLARATION 0F CHRIST P ENCIA i STATE 0F CALIFORNIA, l COUNTY 0F SANTA CLARA, \DOOQONthWN H O I, Christine Placencia, state: Hfl N- I have attached the Notice to Vacate placed on my door September 9, 2021. Lockout is 3 imminentH U) A court trial was held in this matter on September 3, 2021. Ihave attached a tme andp-A i correct copy of the register of actions for this matter that shows that no filing entry exists that -H GM ‘ shows notice of trial or request to set tn'al. There is however, record ofmy Answer demanding a j jury trial and a granted additional fee waiver for the posting ofjuly fees.p- fl I requested that Plaintiff’s lawyer assist in getting the writ of possession cancelled but hepm 00 F refilsed. I have attached a true and correct copy of the email in which he states that he was not_ \D ordered to do so and that the court must order the writ cancelled.NO I have valid defenses to this matter. Absent the immediate order quashing and recaling the NNN- writ I will be irrepambly harmed in that any relief I get in defending the action will be moot. NDJ 0n September 9, 2021, at 10:00 AM, l cause dot be called Plaintiff’s counsel and NA gave notice that on September 10, 2021 at 9:30 AM, in Department 11 of this court, I would NM be making ex parte application for an staying the writ of possession an d shortening time N0‘ for heairin gon the motion for new trial. Plaintifl’s counsel did not indicate whether it Nfl would be contested. NW Ex Pane Application - 3 - OMQO‘MAUJN- NNNNNNNNN-----_--HH mfi¢m#u-o©mflam¥u-o I declare under penalty of perjury under the laws ofthe State of California that flle foregoing is tme and correct EXECUTED THIS 9‘“ DAY OF SEPTEMBER, 2021 AT SAN JOSE, CALIFORNIA. ls/ Christine Plascencia Defendant, In Pro Per Ex Pane Application -4- - Christine Placencia 3277 S White Rd #272 San Jose , CA, 95148 Defendants, In Pro Per SUPERIOR COURT STATE OF CALIFORNIA, COUNTY OF SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMITED MOHAMMAD MUSTAFA, NO. 2 1CV375631 Plamfifis, [PROPOSED ORDER] ON EX PARTE E vs. APPLICATION TO SHORTEN 'ITME AND z QUASH AND RECALL THE WRIT OF j CHRISTINE PLACENCIA; and DOES l to 6, POSSESSION DATE: September 10, 2021 Defendants. TIME: 9:30 AM DEPT: l l IT IS HEREBY FURTHER ORDERED that Defendant’s motion for new trial shall be 23 heard September 202] at AM/PM in Department . Any Opposition to the motion 3 shall be filed and served upon Defendant by September , 2021 at 4:00 P.M. Any reply shall ‘ be filed and served upon Plaintifl‘by September , 2021 at 4:00 P.M. Ex Parte Application -5- l HH F‘O -~-HHH OOQONUIAW NNNNNNNNN OOQQUIhWN-‘O _ N OOONQUIAWN m \D DATED: September 10, 2021 l JUDGE 0F THE SUPERIOR COURT Ex Parte Application -6- CML REGISTER 0F ACTIONS CASE No. 21cvs75631 Mohammad Mustafn vs Christine Placencia Location: Civil Judicial Officer: Johnson, Erik S Filed on: 01/25/202]WWW” CASE INFORMATION Related Cases CascT _ ResidentialUnlawfulDetainer 2|AP002716 (Appcancd) “n mmited(32)-underlo.ooo zlApoozm (Appealed) Case Flags: Fee Waiver Granted St-tistical Closures 04/22/202l Judgment - Clerk Default Judgment DATE CASE ASSICXMENT Current Case Assignment Case Number 2 lCV37563l Court Civil Date Assigned 0I/25/202l Judicial Ofl'lccr Johnson. Erik S PARTY INFORMATION Lead Attorneys Plaintifi Mustafa, Mohammad Siegel, Leo B Retained 83 l -7 l 3-S773(W) Defendant Phcencia, Christine Pro Se DATE EVEN'IS & ORDERS 0F THE COI’RT INDEX 01/25/203“ a Summons: lssucd/Filcd Summons - Unlawful Detainer For: Plaintiff Muslafa, Mohammad ("/25/202' E Complaim-Unlawful Dctainer (Limited): Up to $10K Complaint - Unlawfid Deminer For: Plaintiff Mustafa. Mohammad 01/25/2021 E Supplemental UD 10] For: Plaintiff Mustafa. Mohammad 01/25/2021 fl Civil Case Cover Sheex Civil Case Cover Sheer For. Plaintifi Mustafa. Mohammad 01/29/2021 a UD Masking Letter 01/29/2021 Q UD Masking Lena 01/29/202! E UD Masking Letter PAGE l OF 7 Printed an 09/07/202! al [2:59 PM 0 I l29002 I 02/! 6f202l 02/ 16/202 l 02/ I 7/202 l 02/ l 7002 I 02/ l 8/2021 02/24/202 l 032M202 l 03/02’202 I 03/03/2021 03/ lO/ZOZI 03/24/202 l 03/24/202 l 04/0 I /202 l 04/0 1/202 l 04/02/202 l CIVIL REGISTER 0F ACTIONS cAsE No. 21cv375631 E UD Masking Letter Q Clerk Rejection Letter RE: Motion - Defendant name on motion mus! match exactly how it is spelled an complaint. If you go by the name on the motion please use "sued as. " For: Defendant Placcncia. Christine a Motion: Quash 0224/2! @9. [jam in DJ: Service OfSummom Fees Paid By: Defendant Placcncia. Christine a Proof of Service: Summons DLR (Civil) ProofofServic-e quummons Tomplainl Fon PlainlilT Mustafa Mohammad Fee Waiver Application For. Defendant Placencia. Christine B Fee Waiver Order-Deny DENIED by Judge Overton For. Defendant Placencia. Christine E Motion: om» (9:15 AM) (Judicial Officer: Johnson. Erik S) service ofsummons by DefChn'sline Placenta (inpro per) a Minute Order a Fee Waiver Application-Subsequem For: Defendant Placcncia. Christine m Fee Wai ver Application GRANTED by Judge Overton For: Defendant Placencia. Christine Eowosition/Objecuons For: Plaintiff Mustafa. Mohammad E Motion: Quzsh (9:00 AM) (Judicial 0mm. Imvani-5ani, Nahax) ‘Non Stipulated‘ .rerw'ce ofsummons by DefChristine Placem'a (in pro per) m Minute Order fl Order Def: motion to quash is DENIED and Defshall respond lo the complaint within 5 days: A case status review is set on 4-14-21 a! 9:00AM in Dept. l2. signed Judge lravani-Sani. [Em 6/55427] For: Plaintiff Musmfa. Mohammad a Notice Ruling Denyingerndan! 3' Motion (a QuarkSummon: and Complaint For. Plaintiff Mustafa. Mohammad 04/05/202 I 04/05/202 I 04/08/202 l 04/08/202 l 04/08/202 l 04/08202 I 04/ l 4/202 l 04/ I 4/202 l 04/ 14/202 l 04/14/202 l 04/20/202 I Clvu. REGIst 0F ACTIONS cAss No. 21CV375631 E Notice Notice afFiling afPetr'tionfor Writ (smy rcquesred). by PIacencia inpro per. [2IAP0027I6] For: Defendant Placentia. Christine fl Proof of Service: Summons DLR (Civil) For: Plaintiff Mustafa, Mohammad Against: Defendant Placcncia. Christine E Default Entered For: Plaintiff Mustafa. Mohmnmad Against: Defendant Placencia. Christine B Reminitur [21AP002716] For: Defendant PIacencia Christine a Proofof Service: Summons DLR (Civil) ProofofService ofSummons/Complaim For: Plaintiff Mustafa. Mohammad é: Deraun No: Entered Please list all unnamed occupants in item #6(b)(2). Please note Io use all unnamed occupants in item fl] (c). ProofofServicefiIed on J, 8‘2021 is incomplete. Item #5 is incomplete. For. Plaintiff Mustafa. Mohammad Q Default No: Emma No POS-OIOfor all unnamed occupants. POS-0I0filed on 498/202] isfor Does defendants For: Plaintiff Musmfa. Mohammad E Conference; runner Cue Manngemm (10:00 AM) (Judicial omccrz nmani-San'u Nahal) set per 03/24/2 I M0 E Minute Order Q Request: Dismissal Does Only For: Plaintiff Mmfa. Mohammad a Default Entered "Set Aside Per 5-11-21 Order" Basic as m Christine Placencia only. Does defendants dismissed No pos-Olofor all unnamed occupants. For: Plaintiff Mustafa. Mohammad E Order /0rder. No need to set aside entry afdefaultfi-om 4.15202] because pfitinnerfor Writ of Mandate and Stay was denied on 4(8/2021. l. 0n 4 ”2.2021. Defendant Christine Placenciafiled a Notice ofFiling and Automatic 04/2 l/202I 04/2 I Q02l 04/22/202 I 04/22/202! 04/22/202 l 04/23/202 l 04/23/202 l 04/23/202] 04/261202 I 04/27/202 I 04/29/202 l CIVIL REGISTER 0F ACTIONS CASE N0. 21CV375631 Prevention ofDefau/I. (Attached) 2‘ 0n 4/5 ‘202I. (he clerk entered Requeslfor Entry ofDeflzuII against. Defendant Christine Placencia. 3. The Order denying Petitionfor Writ anandare and Temporary Slay of Trial Cour! Proceeding was denied on 4/8202]. Is the Requesljbr Entry ofDefau/I Judgmenl on 4'5 2021 proper or should it be set aside? For: Plaintifi Musafa. Mohammad Against: Defendant Placencia Christine a ProofofServicc: Summons DLR (Civil) ProofofService ofSummons Complaint re All Others In Possession For: Plaintiff Mustafa. Mohammad m Default Entered ”Set Aside Per 5-] [-21 Order" For: Plaimifi Mustafa Mohammad Against: Defendant Placcncia, Christine fl Judgment: Default "Set Aside Per 5-1 l-21 Order” 3652 Slopeview Drive. San Jose. CA 95148 For: Plaintiff Mustafa, Mohammad Against: Defendant Placcncia Christine: Notice All Unnamed Occupants Clerk Default Judgment (CV) Party (Mustafa, Mohammad: Placencia. Christine: All Unnamed Occupans) Unlawful Detaincr Awarded To: Mustafm Mohammad Enlitlcd to Possession of Premises a1: 3652 Slopcview Drive, San Jose. CA 9Sl48 Awarded Against: Placcncia. Christine Total: $0.00 g Clerk Rejection Letter Default has been entered on 4/1 41202] and 46 “202]. For: Defendant Placcncia. Christine Q Motion: Sc! Asidc/Vacatc hrg.. 04:29?! @9rl5am in D4 Fees Paid By: Defendant Placcncia. Christine Q Opposition/Objccuons Ex Pane Application For: Plainlifl' Mustafa. Mohammad fl Ex Pane Applicmion Er Pane Applicationi’i’f‘a' Stay Pending Hearing For: Defendant Placcncia. Christine E Order: Ex Pane Granting Defs Er Panefor an OST on Malian to Stay and Reliejfi‘om Default on 04/29/21 @9: I5am in D4 by Judge Overlon For: Defendant Placcncia, Christine a Proof of Service: Mail ProofofService ofOppositx'on to Ex Pane Applicafionfor Slay andfor Relieffrom Default For: Plaintiff Mumfa. Mohammad 04/29/202 l 04/29/202 I 04/29/202 l 04/29/202 I 04/30/202 l 05/] 0/202] 05/ l 0/202 I 05/ [0/202 l 05/ l 0f202 l 05/ l 0/202 l 05/ l 0/2021 05/l I/ZOZI 05/ l 3/202 l (15/26/202 l Cn'u. REGISTER 0F ACTIONS CASE No. 21CV375631 E Hearing: Motio- hurings (9:!5 AM) (Judicial Officer: Johnson. Erik S) fa‘ Stay and Relieffiom Defiml! (3e! per 04/262] order) E Minute Order E Ex Pane Application Ex Pane Amlicationfor Stay ‘Mzm be submitted in person” For: Defendant Placcncia. Christine a Opposition/Objections Opposition to Defendant's Ex Pane Application selfor 04-30-202] For: Plaintiff Mustafa. Mohammad fl Declaration Declaration afLeo B. Siege! in Opposition to Ex Pane Application :etjbr hearing an 04-30- 202] For: Plaintiff Mustafa Mohammad Writ: Possession (Issued) ”Recalled Per 5-I [-21 Order“ 3652 Slopeview Drive San Jase CA 95148 Fees Paid By: Plaintiff Mustafa. Mohammad E Hearing: Motion hearings (9:00 AM) (Judicial Officer: lmvani-Sani. Nahal) for Slay and Relieffrom Default (Se! (tr 04 “29 2] M0) ‘Non Stipulated‘ m Affidavit: Pcrcmptory Challenge CCP l70.6 (Judicial Officer: McGowcn. Beth ) For: Defendant Placencia. Christine E Request: Action Deffiled a I 70.6 against Judge McGowan. Granted a Proof of Service Requestfor Action g Minute Order a Order on Def: Peremptory Challenge. Granted -signed Judge McGowen. For: Defendant PlacenCia, Christine m Order Aner Hearing - Pos Hrg 5/10.»?! with Judge Iravani-Sam’: Order afier hearing GMNTING def: ex parle application and motionfor relieffi'am default. ‘Copy Faxed t0 Sherifls‘ For: Plaintiff Mustafa. Mohammad a Dcmurrer rm: ofdemurrer & demurrer Io comp": memo ofp's & a's 07x08“?! @l:3l)pm in DIZ Fm Paid By: Defendant Placcncia, Christine E wm: Possession (Filed) 04/30/21. Unsatisfied For: l’laimitT Mustafa. Mohammad Against: Defendant Placcncia.Christinc 06/08/202 l 07/08/202 I 07/08/202 l 07/ l 3/202 I 07/ I 3/202 l 07/ l 3/202 I 08/05/202 I 08/13/202] 08/ l 3/202 I 09/03/202 l 09/03/202 l 09/03/202 l 09/07/202 l CIVIL REGISTER 0F ACTIONS CASE N0. 21CV375631 Q Memorandum; Points and Authorities RE; Opposilion Io Demurrer ta Complaintjbr Unlzmfill Detainer For; Plaintiff Mustafa. Mohammad fl Haring: Demumr (1:30 PM) (Judicial omcer. lmani-Sani. Nana!) Io the Complain! by DefChristine Placenia (in pro per) Q Minute Order a Answer/Rcsponse (No Fee) Io Complaint. Pro Se For: Defendant Placcncia. Christine Fec Waiver Application FW-002 Additional Fees. For: Defendant Placemia. Christine E Fee Waiver Order-Gmm FW-UOZ Additional Fees. GRANTED byJudge Overlon For. Defendant Placencia. Christine Q Order Def: Demurrer is Overruled: Defshall serve andfile Answer to the complaint within Five (5) days by Commissioner Johnson For: Plaintiff Mustafa. Mohammad a Default Entered BASIC as Io All Unnamed Occupunls 0N1. Y. NOTENTERED as (o Defemnt Christine Placencia as an Answer wasfiled on 7- '13 ‘202/ . For. Plainxiff Mustafa. Mohammad Against: Defendant Placencia. Christine: Notice All Unnamed Occupants E Memorandum: At Issue For: Plaintifi Mustafa. Mohammad Q Trial: Unlawful Miner (9:00 AM) (Judicial Officer. Ovenm Caron a Judgment 3652 Slopeview Dr., San Jase. C4 95 [48. S31. 7I0.89 For: Plaintiff Muslafa. Mohammad Ayinst: Defendant Placcncia. Christine E Minute Order Wn't: Possession (lswcd) 3652 Slnpeview D" San Jme. CA. 951-18 Fees Paid By: Plaintiff Mustafa. Mohammad D \TE FINANCIAL INFOR\I,\TIO.\' Defendant Placentia. Christine Total Chargcs Total Payments and Credits Balance Due as of 9/7/202] Phinfiff Mustafa. Mohammad 3I8.15 3|8.l5 CIVIL REGISTER 0F ACTIONS CASE N0. 21CV375631 Total Charges 348.70 Total Payments and Credits 348.70 Balance Due as of 9/7/202I 0.00 NOTICE TO VACATE Mohammad Mustafa Court: Santa Clara County Superior Conn vs. Court #z 21cv375631 Chrmine Placencia File: 21895204 Ta Christine Placencia 3652 Slopeview Drive San Jose CA 95148 By virtue of a Wn‘t of Possessioaneal Property (EVICTION) out of the above court, you are hereby ordeted to vacate, the pmmises described in the writ, as follows: 3652 Slopeview Drive San Jose CA 95148 Final notim is hereby given that possession of the above described propeny must be delivered to the judgment aeditor on or before: 9l1 612021 @ 12:01 AM. Should you fail to vawte the premises within the allotted time I will immediately enforce the writ by remoan you from the premises. All personal property upon the premises at that time will be turned over to the judgment creditorllandlord, who must return said personal property to you upon your payment of the reasonable cost incurred by the judgment creditorllandlord, in storing the property from the date of eviction to the date of payment. If the property is stored on the landlord's premises, the reasonable cost of storage is the fair rental value of the space necessary for the time of storage. If you do not pay the reasonable storage cost within fifteen (15) days, the landlord may either sell your property at a public sale and keep from the proceeds of the sale the costs of storage and of the sale (CC 1988) or. if the property is valued at less than $700. me landlord may dispose of your property or retain it for his own use. (CCP 1 174) If you claim a right to possession of the premises accruing before me commencement of the action, or if you were in possession of the premises on the date of filing of the action and ate not named in the writ, oomptete and fiIe the attached Claim of Right to Possession form with this office. No Claim of Right to Possession can be filed if the attached wn't states that it applies to all tenants, subtenants. if any. named claimants, if any. and other occupants of the premises. Laurie Smith, Sheliff By. R. VRSCAJ Shen‘ffs Authorized Agent Laurie Smith, Sheriff (408) 808-4800 55 W Younger Ave San Jose. CA 951 1 0 September 08. 2021 5AA". CLAm COUNTY Original Copy CP10 CLNMNTORCLNIMNTSATTORNEYWUMWMDU): 15W "o; ”mm“, ATTORNEY FOR (Namey NAME 0F COURT: Sana Clara County Superior Court STREF' ADDRESS 191 North First Street WUWWSS? San Jose CA 95113 cm mo zua cone: BRANCH WEI Limited me anER: 2 V3 Plaintiff: Mohammad Musmfa 1C 75631 Defendant Christine Placencia ”m””5”“ °””’ . Completed form was recewed on CLAIM 0F RIGHT T0 POSSESSION 0‘91 “me" AND NOTICE 0F HEARING 8y: Comptete mis fon'n onIy if ALL of these statements are true: 1. You are NOT named in the accompanying form sailed Wn't of Posessbn. 2. You occupied the premises on or before the date the unlawful deminer (eviction) action was filed. (1m date is in theemmymg Wn't of Possession.) 3. You stilt occupy the premises 4. A Prejudgment Claim of Right to Possession form was NOT served with the Summons and Complaint. OR this eviction mulls from a foreclosure. NOTICE: If you are being evicted because of foreclosue, you have additional rights and should seek legal assidance immdiately. l DECLARE THE FOLLOWING UNDER PENALTY OF PERJURY: 1. My name is (specify): 2. I (side at (street ad¢ass. unit no., city and ZIP code): 3. The address of “tieW' subject to this claim is (address): a Check hereifthis propertywasforeclosed on. 4. 0n (insed date): , the owner, landlord. or the landlord's authorized agent filed a complaint to recover possession of the pxemises. (This date is in the accompanying Wn‘t ofPossessim.) 5. I occupied the prem'ses on the date the complaint was filed (the date in ilem 4). l have wnb'nued to occupy the premises ever since. 6. [was at least 18 yeats ofage on the date the complaint was filed (the date in item 4). 7. l claim a right to possession of me premisfi because I occupied the premises on the date the complaint was filed (the date in item 4). 8. lwas not named in the Writ of Possession. 9. | understand that if I make this claim of possession, a coun heanng will be held to decide whether my claim win be granted. 10A (Filing fee) To obtain a court hearing on my claim. I understand that afler I present this form to the levying officer I must go to the court and pay a filing fee of $ or file with the court "Application for Waiver of Court Fees and Costs.‘ I understand that If I don't pay the filing fee or me the form for waiver of court fees withm 2 court days, the coun will immediately deny my claim. 11. (Immediate court hearing unless you deposit 15 days' rant) To obtain a court hean‘ng on my claim, I understand I must also present a copy of this completed complaint form or a receipt from the levying officer. I a|so understmd the date of my hearing wifl be set immediately ifl do not deliver to the coun an amount equal to 15 days‘ rent. (Continued on revetse) 6910 (Rev. July 1_ 20m cm“ 0F RIGHT To ”5555530” Cod. o!cmPym, 55 115.010. 715.020, mu AND NOTICE 0F HEARING lmmmm LOFN 21 895204 CP‘IO PI , m n.0hammadI.“ assume! C. . . Pl . 21CV375631 12.Ianflhgmycunhmefdm‘gmwwmmmmmywaeMyutm.Mommawunmmm “Wamdmwnhmaamgofiwfsmux a. C] Iptmfiedfi'sda‘mfomhomeshufl,mshal.orwter|evyhgdfiw,m0mnmmdayslsculdeivabme camheblkxmgjnawpyofmwaedclainhmorareca'pLQHheoanfiingbeorfombrpmoeedng'n fomapmper‘s,au(3)anamountequalm15days‘lurr.or b. E lmtedflisdaimformwmm,m.amlemofficenmomnmmdaysisrfldemmm cwn(1)aoopyofth'scompletadda’mmorateoeipt.and(2)|hecourtfiingbeorfotmhpmceofiginform papers. WORTH“: mmmamdmmmbmmmmmmmmehhmm orderlevyingoficet. (Toqummq Dateofhea‘ng: Tm: Demotm; Room Addressofcourt L N01105: Ifyoutaitoappeuatth‘stnm youwilbeevmu' mama“. I 13. WMlmmwwmatappymwu): a Dmmmmmmmd. _ [j awriflenretmlagreememwithmelardad. . [j mordretmlagleamntwithapersondhermanuem. [j amifienreuflagteemerfiwflhapersmufimflmhhflud.Dawwwfinmmmwhmww. C: M(expm’n): 399.90 IWMMdpummfiemwflededmmmmsmmm L WARNING: Papy'safebnymwuauebyimisumumeswem j DMmmm “MGM m: NOTICE: Ifyomcumbpm‘nbundbbevfltheuMMawonangyou MlbedeteminadatmAttrial.youmaybehmdiableforra1m§s.and,insomem.ueble danages. - NOTICE TO OCCUPANTS- YMIISTACTATOHCEidemMngaem:YmeOTMhmveonnmfledMitofW;wammmmmhdahmmmnvmhfimmmw Yousfilloccupytheptembes.Ammcm¢wmpmmmm1wwm3meORywummmmm. YoucancomalehandSUMTTflSClAflFORl (1) Bemuedmdewmauemirsamstusmmmmmx M» Nr- (2) ORdfiepImmdthefmediheevicfion.(Givefiiskxmmvleoflbsrmcamstomm) Ifyoudondoompmmwnittfisfovm(aflpayafiirgheorflefiebrmforpmceeflwghmapamuisifywampayme be).YOUWILLBEEVICTEDabngwflhhepafisnmndhthewrit Aflerthisform'spmpetfifled.AHEANNG\MLLBEHELDtodeddayourda‘m.Ifyoudonotappeaatfisoheaingnflbe WWaflmflerheaing. cmotmutznn CLAIIIOFRBHTTOPOSSESSION "'""' Am NOTICEOF HEANNG EJ-130 ATTOMEY 0R PARTYWW ATIOMY.’ CITY: santa C1112 Mime N0-= (83 1) 768-91 10 “ME Lco B. Sicgcl, Esq. FIRM NAME STONE - SIEGEL LAW FIRM STREEYWESS- 1726 Scabright Ave. EMAIL ADDRESS: leob@legalsiegel.0rg ATTORNEY FOR (now Plaintiff Mohammad Mustafa [I] ATIORNEYFOR m onmmmmcneonoa m ASSIGNEOFECMD 51M: BAR Mo; 116841 m COURTUSEONLV sure: CA vcooe 95052w no: (83 1) 713-5797 BRANCHNM SUPERIOR coum 0F CALIFORNIA, COUNTY 0F SANTA CLARA STREETADDRESSI 191 N. First St. “*1“;“DRE” 191 N. First St. C‘WM’Z" °°°Er San Jose 951 13 PLAINTIFFIPETITIONER: Mohammad Mustafa casewuaen. DEFENDANT/RESPONDENT; Chn-stine placencia 21CV375631 D sALE E: EXECUTION (Money Judgment) m Limited Clvll Case WRIT OF 33 POSSESSION 0F E] Penonai Property (including Small Claims)D Unlimited Civil Casem Real Pmpeflv (induding Family and Probate) 1. To tho Sheriff or Marsha| of the County of: Santa Clara You are directed to enforce the judgment described below with daily iMemst and your coas as pmvided by law. 2. To any registered process scrver: You are authorized to serve this writ only in accordance with CCP 699.080 or CCP 715.040. 3. (Name): Mohammad Mustafa is the m original judgment creditor D asségnee of record whose address Is shown on this form above the court's namel 4- Judgment debtor (name, type oftaga/ entity ingot a 9. m Wn't oi PossessionMfit of Sale information on next page. natural person, and last known address): 10.D Thls writ is issued on a sister-state judgment. I_ Christine Placcncia 3652 Slopcview Dr. San Jose, CA 95148 - For Items 11-1 7, see form MC-012 and form MC-013-INFO. 11. Total judgment (as entered or renewed) 5 ' 12. Costs after judgment (CCP 685.090) S 13. Subtotaa (add 11 and 12) s 0.00 J 14. Credns to principal (after credit to interest) sj Additional judgment debtors on nan page 15. Principal remaining due (subtract 14 from 13) S 0.00 16. Accrued interest remaining due per S 5. Judgment entered on (dale): 9/3/2021 CCP 685.050(b) (not on GC 6103.5 fees) (See type ofjudgmen! in item 22.) 17. Fee for issuance or writ (per Gc 7062mm) s I40 . oc- d I’ 5‘ a Judgment renewed 0n (dam); 1a. Tom amount due (add 15, 1s, and 17) s 0:00 19. Levying officer: Lb_ (r A‘p ' . a. Add daity interes‘ from date of writ (at 7' "once 0' “I. u mWm the legal rate on 15} (nor on fli/a- m “as “°‘ ”e9" “mm“- Gc 5103.5 fees) ................ s b. D has been requested (see next page). b. Pay directly to court costs included In 8. D Joint debtor Information on next page. 11 and 17 (GC 6103-5. 58537; CCP 6995200)) ................ $ 20E The amounts called for in items 11-19 are different for each debtor. These amounts are stated for each da on Afiachmant 20. fl ¢ Date: SEP o 7 2021 Clerk. by A. VILLANUEVA .Deputy NOTICE TO PERSON SERVED: SEE PAGE 3 FOR IMPORTANT INFORMATION. I p ‘ uIq- o " ' . m5m.712010. 5.0 0mwmgomuua WRIT 0F EXECUTION 006-“me 55 cm 57:31”; H130 [R.v.8w I.m www.uowMN“Wad Caly'ornia Judicial Council Penn: EJ-1 30 Plaintiff/Peflflonefi Mohammad Mustafa Defendant/Respondenti Christine Placencia WW 2 lCV375631 21.E Additional judgment debtods) (name, type allege! enfily Knot a natural person. and last known address): l- -' l- |_ _. |_ 22. The judgment ls for (check one): a. E wages owed. b. E mild supponorspousalsuppon. c. D other. 23.C] Notice of sale has been requested by (name and address): l- ‘7!- L _Jl_ 24.E Join! debtor was declared bound by the judgment (CCP 989-994) L__J a. on (date): a. on (date): b. name. type of legal entity It not a namm pemon, and b. name, type of legal entity if not a natural person. and last known address ofjoint debtor. last known address of joint debtor. l- 7F- |_ __l|_ _‘ _J c. D Additimal costs against certain joint debtors are Itemized: E below E on Anammem 24c. 25.m (Writ of Possession 0t Writ of Sale) Judgment was entered for the folbwing: a. m Possession of real property: The complaint was filed on (date): January 25, 202] (Check (1) or (2). Check (3) ifapp/icaue. Complete (4) if(z) or (3) have been checked) (1) m The Prejudgmenf Claim of Right to Possession was sewed In compliance with CCP 415.46. The judgment includes all tenants. sublenants, named claimants, and other occupants of the premises. (2) D The Prejudgment Claim of Right (a Possession was NOT served in compliance with CCP 415.46. (3) E The unlawful detainer resulted from a foreclosure sale of a rental housing unit. (An occupant not named In ma judgment may file a Claim o! Right to Possession at any lime up to and Including the time the levying officer returns to effect eviction. regardless of whether a Prejudgmen! Claim of Right to Possession was served.) (See CCP 415.46 and 1174.3(a)(2).) (4) If the unlawful detainer resulted from a foreclosure (item 253(3)), or if the Prajudgment Claim of Right lo Possession was no! sewed in compliance with CCP 415.46 (item 25a(2)). answer the following: (a) The daily rental value on me date the complaint was med was 5 13333 (b) The court wilt hear objections to enforcement of the judgment under CCP 1 1 74.3 on the following mas (spawn: Monday - Friday 8:15 a.m. Item25oonn'nuodonnextpago Emu Inn.M1.mu ' WRIT OF EXECUTION munWWGWWWFM EJ-130 PlaintiffIPemioner: Mohammad Musmfa usemac Defendanthespondem: Christine plucncia 21CV375631 25. b.D Pomssion of personal propetty.D If delivery cannot be had, then for the value (itam'ze in 25o) specified in the judgment or supplemental order. c. D Sab of personal property. d. E Sale of real property. 8- The property is descn'bed m betaw D on Attachment 25c. 3652 Slopeview Dr., San Jose, CA 95148 (Santa Clara County) NOTICE TO PERSON SERVED WRIT OF EXECUTION OR SALE. Your rights and duties are indicated on the accompanying Notice of Levy (form EJ-150). WRIT 0F POSSESSION 0F PERSONAL PROPERTY. If me levying officer is nm abie to take custody of the property. the levying officer wm demand that you turn over me property. If cusmdy Is not obtained following demand, the judgment may be enforced as a money judgment for the value of the property specified in the judgment or in a supplemental order. WRIT OF POSSESSION OF REAL PROPERTY. If the premises are not vacaced within five days after the date of service on the occupant or, if service is by posting, within five days after service on you. the levying officer will remove the occupants from the real property and mace the judgment creditor in possession of the property. Except for a mobile home. personal property remaining on the premises will be sold or otherwise disposed of in amdanoe with CCP 1174 unless you or the owner of the property pays the judgment creditor the reasonable cost of storage and takes possession of the personal property not later than 15 days afler the time the judgment creditor takes possession of the premises. EXCEPTION IF RENTAL HOUSING UNIT WAS FORECLOSED. lf the residential propeny that you are reniing was sold in a foreclosure. you have additional time before you must vacate the premises. If you have a lease for a fixed term, such as for a year. you may remain in the property until the term is up. If you have a periodic lease or tenancy. such as from month-io-month. you may remain in the property for 90 days afler receiving a notice to quit. A blank form Claim of Right to Possession and Nob'ce of Hean‘ng (form CP10) accompanies this writ. You may claim your right to remain on the property by fining it out and giving it to me shen'ff or levying oficer. EXCEPTION IF YOU WERE NOT SERVED WITH A FORM CALLED PREJUDGMENT CLAIM 0F RIGHT TO POSSESSION. If you were not named in the judgment for possession and you occupied the premises on the date on which the unlawful detainer case was filed, you may object to the enforcement of the judgment against you. You must complete the fonn Claim of Right to Possession and Notice of Hearing (form CP10) and give it to the sheriff or levying officer. A blank form accompanies this writ You have this right whether or not the property you are renting was sold in a foreclosure. mo IM- s-vm- 1-2m WRrr 0F EXECUTION P-o-m LatrNtdsOAutomudWWW Council Form: p- } Christine Placencia J 3277 S White Rd #272 ; San Jose , CA, 951482 3 4 5 6 7 8 9 ; Defendants, In Pro Per HhflH Nr-G MOHAMMAD MUSTAFA, Plaintifl‘s, 1 vs. ----- QM#M CHRISTINE PLACENCIA; and DOES l to 6, ‘ Inclusive, Defendants. NNNNNNH-- UI-hbJN-‘OOWQ SUPERIOR COURT STATE OF CALIFORNIA, COUNTY OF SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMITED NO. 2 lCV375631 [PROPOSED ORDER] ON EX PARTE APPLICATION TO SHORTEN TIME AND QUASH AND RECALL THE WRIT OF POSSESSION DATE: September 10, 2021 TIME: 9:30AM DEPT: 1 l ‘ TO THE PARTIES, COUNSEL and SHERIFF: Upon the ex parte application of Defendant and good cause appearing therefor, IT IS HEREBY ORDERED that writ of possession in this action is hereby STAYED pending further 5 order of this coutt. heard September IT IS HEREBY FURTHER ORDERED that Defendant’s motion for new tn'al shall be 2021 at AM/PM in Department . Any Opposition to the motion shall be filed and served upon Defendant by September , 2021 at 4:00 P.M. Any reply shall ; be filed and served upon Plaintifl‘by September , 2021 at 4:00 P.M. N0‘ NN WV Ex Parte Application -5- l 2 3 4 5 6 7 8 9 10 ll 12 l3 l4 15 16 l7 18 19 20 21 22 23 24 25 26 27 28 DATED: September 10, 2021 JUDGE OF THE SUPERIOR COURT Ex Parte Application _ 6 _ H 3277 S WhitcRdfl'lZ SanJosc,CA, 95148 SEP 1 0 2021 '1 Defendants In Pro Per Clerk of the urtSmml av neon RYAN NGUYEN SUPERIOR COURT STATE 0F CALIFORNIA, COUNTYOF SANTA CLARA DOWNTOWN SUPERIOR COURT, LIMImD WQQGMwa 5-H hie MOHAMMAD MUSI'AFA, NO. 21CV375631 Plaintifi‘s, W ORDER] ONEX PAKI'E vs. APPLICATION T0 SHORTEN TIME AND QUASHAND RECAIL THE WRITOF Cfmlsm PLACENCIA; andDOES l Io 6, POSSESSION Inclusive, DATE: Septunber 10,2021 Defendants. TIME: 9:30AM DEPT: ll u-nu-ao-Iv-to-n O‘M5wN Hm “‘1 TO THE PARTIES, COUNSEL and SHERIFF: HW 8 hea.~;l\5 ils‘ Aercé), Jg-I-oq Idefeqdaa+ ”06b 53+ 34¢ P/q cen c:cLIJ {liaef‘bgdavfuj ex 'Pa'nft ffgueu‘ upon d‘w‘ay o!" a,xgx‘fim,“ _Q'\d J‘or'jftnjnj +144: J‘op Aaww’vfj on _I‘_~§"ju¢Jf' +e quaJA o-qd (-tu.” mna-r 0F FDJJ-CJJ/Oq) a3 fb/IOMJ': #8 Our {n 1 mo’ldc‘yl ‘S’gfiifflfl 6gp [3/ Jug"j Qf 9:00 QM In Dcpf' ll. p/al'n+iH'J C’ound‘t/ J‘AQ" JW‘UQ °- CW‘V °{ 7’41}: Order vch Email 6‘7 q“’°‘&bal Md c.lJ-D ppoolde. ,MMfid ia-d-e 4g f-cp/uunic. 2 Q) :I. fl R&k’fi 3'3 ,lof2* fl “0+;ce- ¢‘ 0‘ Je‘ darl+’ PPGO! O f SUU;LQ 5A0.” 5., pnangoj a-I- +Le 1 DATEIxSepcemberlo,2021 ~ - +’.MQ o’cfl‘ Aura). 2 ” rrIJ‘ Jo 0&08150- 3 00km (9:3 , ‘ '4 wnGEOansupsfifoiicoum t 5 1‘ Judge Caro! Oveflm 6 . 7F 8 9 10] III 12 13 27CaL-J70.‘ 04015-11 0A) 5x pfimre 28 Llevd}563/ gprLIC¢+,.n F (i252: DECEL‘) 1 Lm B. Siegel. Stare Bar No. 116841 SEP 1 0 2021 STONE - SIEGEL LAW FIRM 2 1726 Seabrigm Ave. s Clerk t the Court Santa Cruz. CA 95062 BY “9"“ CW" 0me at Sam. Cam 3 831/713-5773 Telephone DEW" 831/713-5797 Facsimile 4 lcobfqfllegalsicgelorg S Attorney for Plaintiff, MOHAMMAD MUSTAFA 6 7 8 SUPERIOR COURT OF CALIFORNIA 9 COUNTY OF SANTA CLARA 10 l l l2 MOHAMMAD MUSTAFA CASE NO. 21CV375631 [3 Plaintiff. Date: September 10, 2021 Time: 9:00 am. l4 vs. Dept; 1 l Judge: Hon. Carol Overton 15 CHRISTINE PLACENCIA; and DOES 1-6, inclusive. OPPOSITION DECLARATION AND l6 MEMORANDUM OF POINTS AND Defendants. AUTHORITIES IN OPPOSITION TO EX 1’7 v" PARTE APPLICATION MOTION FORORDER SHORTENING TIME FOR NOTICE OF 18 MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION l9 Date Acu'ou Filed: January 25, 2021 20 Trial Date: Post Trial Modon 2! I, Leo B. Sicch declare: 3‘2 l. I am an attorney a law, licensed Io pracu'ce in the State ofCalifomia, and am the attorney 23 of record for the Plaintiff in this action. l have personal knowledge of the facs set forth in this 24 declaration, and could testify competently to Ihcm if called as a witness to do so. 25 2. This is an unlawful dctaincr acfion. Plaintiff acquired title to the subject Property from 26 Defendanl‘ s lender, afier the lend er had foreclosed under the power ofsalc sct fonhin a deed ofu’ust 27 i1 held aginst n'llc to the Propcny. which instrument secured a loan it had made lo the Defendant. ., .-.8 l OPPOSITION 1'0 EX PARTE APPLICATIQN FOR ORDER SHORTHING TIME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION I~J After having served Defendant with the requisite 3-Day Notice of Termination 0f Tenancy (after foreclosure). and 3 dayfi then having passed. Plaimi ff‘s complaint for Unlawful Dctainer was filed on January 25. 2021. That is almost 8 months ago. Furthermore, going back to the time the bank started its foreclosure proceeding to remove Defendant from title Io the subject Property, she has withheld possession from its Iightful owners FOR OVER TWO YEARS. After 8 months of numerous dilatory mofions filed in this Court. the case was set for a coun trial on September 3, 2021 before Lbe Hon. Carol Overrun. in Department 11 of the Com 3. On the day for trial. [he Conn waited until 9:30 am. for Defendant to appearwhen the case was called‘ However. Defendant made no appearance cither in person, or by electronic means. The Court than specifimlly noted on the record that the Clerk of the Court had duly notified Defendant of the Trial date and time with a Nou'cc of Scheduled Unlawful Dctainer Trial Date that was mailed to the address of record for the Defendant. The Notice was cmered in evidence as Exhibit l. ._S'_eg, Exhibit "A " attached to this opposifion brief. 4. Defendant appears to have consulted with attorney Kenneth Carlson, from Idylwild, California. who is known to operate a business named California Tenant Law, and who adveru’ses on the intcmct as beingable to assist tenants in thwarting their landlord‘s efforts to evict them as pro per defendants. Mr. Carlson's website may bc found at caltenanflawcom. He advertises a plethora of legal ids and services that arc sold to tenants and which are designed to delay the process of rcmovmg tenants from possession ofa landlord's real property, and claims that the courts and judges regularly violate the law in efforts to cooperate m'th landlords evicfing their tenants. Despite the fact Defendant PLACENCLA is appearing in propria persona in this action. attorney Carlson‘s office is providing her guidance throng his interact progams. as he is me individual who has signed Proofs of Service for Defendant's pleadings throughout this action. 1n addition. on numcrous occasions during this action, Defendant’s counsel has been contacted on me phone and by email by one of Mr. Carlson's associates. who notified Plaimi ffof the Defendant's intent to appear on the court's cx pane calendar for vafious motions she has filed in this acfion. all successfully delaying her being removed from possession of Plaintiff‘s Property Huh u‘ OPPOSITION TC) EX PARTE APPLICATION FOR ORDER SHOR I'ENI'NG TIME FOR NOTICE 0F MOTION FOR NEW IRIAL AND FOR STAY OF WRIT OF POSSESSION 5. By way of backgound. Plainu‘ff submits the following u'mc line in this acu'on: 12/30/20 l 9: 12/30/2020: 0 1/08/20! l: 01/25/2021: 02/09/202 l: 0 3/ 10/202 l: 03/24/202 l: 04/01/202 l: 04/02/202 l: 04/02/202 l: 04/05/202 l: 04/082021: 04/ l 4/202 l: 04/2 1/202 l: 04/22:": 21: A Trustee's Deed Upon Sale was recorded as Document No. 24368498 in the Official Records of Santa Clara County. which relieved Defendant of title to the subject real propeny located at 3652 Slopcvicw D11, San Jose, CA 951 48 (hereinafter “the Property"); Plainn'ff. MUSTAFA acquired title Io the Property from the foreclosing lender with a Grant Deed recorded as Document .\o. 24769045 in the Official Records of Santa Clara County. II is nomble that Defendant had by then likely been living both rent- free and mongagc-t‘ree in the Property; Defendant was served with the 3-Day Notice to Quit pursuant Io Code of Civil Procedure § 1161a. which notice formed d1: underlying basis for this Unlawful Dctaincr action; Unlawful Detaincr Complaint was filed; On or about 2/9/2 l. Defendant filed a Motion to Quash Service of Summons. based only on the gound that she had not by that date been served m'th the Summons and Complaint in this action; Plainfiff‘ s Opposifion to the Quashal modon was filed, attaching copies of 2 separate Proofs of Service of the Summons and Complaint servad on the Defendant; After hanng conunued [he heanng on the Defendant's Motion to Quash. the Court in Department 12 (Hon. Nahal Iravani-Sani) heard and denied the mofion, ordexing Defendant to file an Answer to the Complaint within 5 days. The Conn further ordered the parties Io return to Department 12 on April l4, 2021, at 9:00 am. for a Case Stams Review Hearing; Nou'cc of Entry ofOrdcr Denying Defendant‘s Mofion to Quash was filed; Defendant filed a document enu'thd “Notice 9f filing and_ A_u}omatic Prevention of Default," withouL as required. havmgscrvcd II on the Plamutf; Some time between April 2, 302] and April 8, 2021, Defendant filed, but did not serve on the Plaintiff. a Petition for Writ 0f Mandate and Temporary Smy of Trial Conn Proceedings; Court Clerk miu'ally entered Defendant‘s default; The Court's Appellate Division denied the Defendant‘s Pefifion for Writ of Mandate, indimting that along with her pcfiuon, the Defendant was not prevented from filing a response Io the Complaint The Conn reviewed the smtus of this case in 1i V t of the Appellate Court‘s rejection of Defendant‘s Pctiu'on for Writ ofMandatc an StayofTrial Court Proceeding. The Conn ordered that Plaintiff should resubmit a Request for Envy of Default and Default Judment: Pursuant to the Court‘s Order, a new Request for Entw of Default and Default Judgnem were filed and entered: Judgment for Possession of the Property in favor of Plaintiff was entered; § OPPOSITION TO EX PARI‘E APPLICATION FOR ORDER SHORTENWG TIME FOR NOTICE OF MOTIW FOR NE“? TRIAL AND FOR STAY OF \VRIT OF POSSESSION 04/23/2021: Defendant filed a Mou’on for Relief from Default. intending to file a Dcmurrcr to the Plainu'ff‘s Complaint for Unlawful Dctainer. Ax the initial hearing on that mou‘on, Defendant lodged a Percmptory Challenge to the matter bemg heard by a Commissioner. whereupon. it was continued to May 10, 2021, before the Hon. Cynthia C'. Li, "m Department 12. 05/10/202 l: Defendant's Motion for Relief from Default was gamed when Judge Li found that the Court Clerk's confusion lcad Io Defendant's Dcmurrcr not being timely filed; the Court‘s order gmmed Defendant rcliefto file an Answer or a Demurrcr within 5 days. 05/13/2021: Defendant filed a Dcmurrer to the Plainfiffs ComplainL [I was set for hearing initiallyon June l6. 203 l , in Department 4. before Commissioncrlohnson. However, the Court conu'nucd the hean'ugsua spouts, to July 8, 2021 in Dc artmcnt 12. before the Hon. Naha] lrvani-Sani. wBen it wm determined that DefenSant had previously challenged Commissioner Johnson. 07/08/202 l : Judge vaani-Sam overruled Dct'cndams‘ dcmurrcrs lo the Complaint. and ordered that an Answerto the Complaint be filed within 5 days. The Clerk‘s Office forwarded the filed Order to Plaintiff‘s counsel on August 5. 2021 Although Defendant never bothered to serve Plainu' ff with a copy of her Answer to the Complaint, the Court Clerk eventually advised Plaimi ft‘s counsel that an Answer was indeed filed on the last date the Court provided for her to do so. A Request to Set Case for Trial was then filed. and the trial was scheduled for September 3. 2021 in Department l l. before the Hon. Carol Ovenon. 09/03/202 l: Dcfcndam failed Io appear at m'al by 9:30 a.m.. despite having been duly served with the Clerk's Non'ce of Scheduled Unlawful Dctaincr Trial Dale, which was mailed to her at the address she filed with the court SeeExhibit "A. " Judgment for possession, was entered in Plainu'ft‘s favor. vn'th an award of holdovcr damages and costs of suit in the sum of $3] 710.89. See, Exhibit "B. " l declare under penalty of perjury that the foregoing is Lruc and correct. and that this declaration was executed on September 9. 202 l. at Santa Cruz, California. /5/ Leo B. Siege] 1’ MEMORANDUM OF POINTS AND AUTHORITIES IN OPPOSITION TO EX PARTE APPLICATION MOTION FOR ORDER SHORTENING TIME FOR NOTICE OF MOTION FOR NEW TRLAL AND FOR STAY OF WRIT OF POSSESSIONaw I‘ IN LIGHT OF THE FACT THE TRIAL COURT ENTERED A FINDING ON THE RECORD AT TRIAL ON SEPTEMBER 3. 202 l . THAT DEFENDANT HAD BEEN DULY SERVED BY MAIL TO HER ADDRESS OF RECORD AT THE COURT WITH THE CLERK'S NOTICE OF SCHEDULED UNLAWFUL TRIAL DATE. 4 OPPOSITION TO EX PARI'E APPLICATION FOR ORDER SHOR I'ENING TIME FOR NOTICE OP MOTICN FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION domhw 000 SHE CAN NOT SATISFY THE CODE OF CIVIL PROCEDURE § 473(b) REQUIREMENTS FOR RELIEF FROM DEFAULT OF A SHOWING OF “MISTAKE, INADVERTENCE, SURPRISE OR EXCUSABLE NEGLECT.“ In yet a further effort to continue withholding possession of the subject property from its rightful owner, Defendant now seeks to move the mun for a ncw tn'al and a stay of Plaintiff s Writ of Possession that was issued on September 7, 202 l. Plaintiff is unaware of the grounds for this application, for as is her usual practice, Defendant has failed to scn'c Plaintiff with a copy of her plcadings 'm suppom'ngit. Assuming, however. that it is based on Code ofCivil Procedure § 473(b), claiming that her failure to appear at trail was through “mistake, inadvcnencc surprise, or excusable negcct." this application and any stay of Plainu'ffs Writ of Possession. should be denied. Inasmuch as itmu not be questioned that the Clerk ofthe Conn served Defendant with proper notice of the trial in this action. which was mailed to the address Defendant provided Io the Court, with no notice ever having been filed changing her address. this is simply a matter where the Conn should find that “ENOUGH IS ENOUGH.“ Defendant has now live mortgage and rent free for over two ('2) years. That delay in the bank and the Plainfiff in this acu'on recovering possession of their property is not even attributable to any C'ovid-l9 delays It an'ses enu'rcly out of the Defendant‘s numerous, unsupponable modons, and last-minute challenges, all of which have becn denied. that have mused delay after delay in bring'ng this action to trial. Then when she failed to appear at uial. it seems Defendant will now claim that her failure to appear was through some unknown mistake. inadvcncnoc, surprise or excusable neglect, mereby scekmg yet a further delay of perhaps months before this case cvcr gets to a final rcsoluu'on. ll. SHOULD DEFENDANT CLAIM THAT A NEW TRIAL SHOULD BE GRANTED BECAUSE SHE HAD PREVIOUSLY CHALLENGED THE TRIAL JUDGE‘ IT SHOULD BE BACKHANDED. AND THIS APPLICATION DENIED: BECAUSE PLAINTIFF HAD RECEIVED NO NOTICE OF ANY CHALLENGE HAVING BEEN NOTICED. OR GRANTED. Plainn‘ffis advised that while Defendant failed to appcax at trial on September 3. 2021. she objects to the Hon. Carol Ovcnon having heard the tn'al. on the wound that Judge Overton had been preempted under Code of Civil Procedure § 170.6. Any such argument submitted in suppon of a mofion for a stay ofexccution of Plaintiff‘s Writ of Possession and in support ofa motion for a new g OPPOSITION TO EX PARTE APPLICATION FOR ORDER SHORm0 TIME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION IJ Lu 'Jl trial should be denied. Plainu' ffnevcr received notice ofany peremptory challenge to Judge Ovcnon‘ s jmisdicu'on over the case and the parties The only challenge Defendant is known to have made was of Commissioner Johnson hearing any matters in the case, and consequently. be did not presidc over thc trial proceedings. Therefore. should Plainfit't‘ assert a peremptory challenge in support of her present ex part: applican'on, it should be iyorcd and this application denied. CONCLUSION Baed upon the foregoing points and authorities and the argument included herein, ?]an urga the Court to deny Dcfendam’s Ex Pane Applimu'on to Smy the Wn't of Possmsion issued in this ms: on September 7. 2021, and any order authoria'ng the filing of a motion for a new trial. Dated: September 9. 2021 Respectfully submitted. STONE-SIEGEL LAW FIRM /5/ Leo B. Siegel, Attomcy for Plaintiff 6 OPPOSITION TO EX PARTE APPLICATION FOR ORDER SHORTENING I'LME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION 25 EXHIBIT A .7 OPPOSITION TO EX PARTE APPLICATION FOR ORDER SHOR I'ENING TIME FOR NOTICE OF MOTION FOR NEW IRLAI. AND FOR STAY OF WRIT OF POSSESSKINE Sl'l’ERIOR COl RT OF CALIFORNIA COl'NTY 0F SANTA CLARA [NIVT-Tt‘fs ‘N \ (N II I Lix‘l ‘-i \ .: ki‘u'lL DiVl‘lH“ Leo B Siegel Stone ' Siegel Law Firm 1726 Seabright Ave Santa Cruz CA 95062 RE Mohammad Mustafa vs Christine Placencia Case Numaer 21CV375631 NOWCE OF SCHEDULED UNLAWFUL DETAINER TRIAL DATE The above entree case has :eev sea for (r591 .r: :ws Cow. and you are dweczed to appgar Owe: September 03. 2021 Tume 9:00 AM Dem: Department 11 No fume: wonce mu De gwen Dy the Com Note Ire ic‘mwrg 0f you have reze wed notzce tnaz an apohcamn :or wane! of sour: fees has been demed. faiure to pay fees tn a :nmely manner may 'eSui'. :r me com trza! bezng vacazed mzhom tamer nonce and (he Ptamrifl may proceed vnm :efam: and ce'auli juegment For further mfcrrzznrm carwtact me Caiendsr Office at (408) 552-2100 e.’ ya. a Daria rea'esertec :2,- ycu fl 4 Mine“. 10 be canes an Lemar! m ma: party reec anc acoamrmcancr wee! me Ammcan mm 9.5‘ecwhes Act. :vrcasr contact the Czar? Adr'mwmcr e afiue a: :435- $824723 c: use me Cour s: TDD ‘nne 1-108: 682-2690 er me .one TDD Ca, ?i‘m‘a 9-H.” Sewrce @in ‘r’Ti-ZS'vS‘Z DECLARATION OF SERVICE BY UNI. I :em'e mJer 9213.“, 2' :er-x.‘ zra: I sang: mu nonce ty emrcsrg a sme- cop; m a seabed eme ice 3:?93'5634‘, m 9.3.2”. pe'sc" M‘ose :t'ame ls sr‘rmr‘ arm: 3"? 3-, 3:005:3er the emacpe awn :ostage mm, uremic [rt m: w ; ‘.'»3~ 3' $3 ncse CA cr AJ-gus' 21’ 2:2? C‘Eqn 0F 'HE COLR’ n; 53mm Veea Decay: cc. Cumin": 9'4“:va a 3277 5 Vfluh: Rd #272 Sax: .53: LA 95-1467 Cv-aora Rex:m 2:; ...-_ CASE N0 Eli Nfzbbz EXH:_ Via ldent‘rfication 9:] Admitted Lg“: ' {‘A'vcmgr VS. f 110.5%; 1 J - ’2 " f: iDATE' CLERK' .J Morriss 3‘ EXHIBIT “B” 8 OPPOSITION TO EX PARTE APPLICATION FOR ORDER SHOR TENING TIME FOR NOTICE OF MOTICXV' FOR NEW’ IRIAL AND FOR STAY OF VVRJT OF POSSESSION UD-HO r Afimonrunmmcuunmsnm.suum.nm; mmrmmr Leo B. Sic c1 Esq. (Sane Barn 1168M; i ”STONE- IEGEL LAW FIRM I726 Seabri%htgso.méMc Samarrm mp mm,9(53301) 703 91 m m-o :ww' (83:) 7x3-§797 Iem mans ma ,eohzaglcwlufidor' F I hAficnnm/w Plamuff. MO AMMAD ‘leSTAI A swemon count oscAuFoRMA, comm! or SAN“! A CLARA n sacrumss 191 N. Firs! St SEP 0 a 2021 wmnmiss 191 N. Firs: SK. w-wM-m San Jose 95! 13 WWMMP MW“. FF‘ MOHAMMAD MUSTA I5A DEFENDANY' CHRISTINE PLAl TENCIA JUDGMENT-UNLAWFUL DETAINER W5 Mmfifl ‘-:-: 3V cm“ L- By Defauu -iJ After Court Tnas . Li; 8y Court L: Possessm Only 3 Detencanl mu Not 2'CVJ7503] Appear a! Trial JUDGMENT 14 g... av DEFAULT a 004m: was ampem' served with a copy o! tho summon; and comm Defendant {axtea to answev me comctam'. o: aspeav and Celene Ire ammo wd'nin We me armed by 93wD c Delewdarfs default was. enterec’ by me c erk upm piamhfl‘s application. d D Clerk‘s Judgment (Code Siv "rec . g 1169‘” foe possesmn only of the maniacs deecntw on page 2 (item 4). a . Cour: Judgmom (Code Cw. Proc . § 585m. Tho cum sonsmma (1) ._...' plaimifl's iesumony aw olner emceme (2) piamtt's or cthem‘ wmm dactarahoc and evooence (Code CN' Pro}. § 585(6)). a. Tho case was tried on (daleandml September 3. 302} before (name oljudiciadoifioer): Hon. Carol ()vcrtun a Appeatances Dy [a Warm mam» eacm- l "S? I Plamm s ammey (harm each} Mohammad Mustafa (1' Leo B. Siegel (2‘ | i Confirmed 0'1 Atrammm (lam MC-U25)‘ - x I De:endam (name each): 1 Defendant s attorney (name each): Christine Piacencia (‘4 (23 ' Cwlmued w. Albanian: 2:. (mm MC-C’ZS). c m Deienda'n did nm appeal al mu Ddenaam was pmpex'y served war: name oi 1am. a [3:] Aszaxomemofdocusion(CodeCiv.Proc..§632; m wasnot C; was requested hp." tmwuwuw Juoemsm-UNLAWFUL nemmaa °°"°‘°"’mfiffi uoumm- maytm (twang;“medCdmaaw.’ cum! Farm L PWWF'Mohammad Mustafa 3 mun!!! DEFENDANT: Christine Placcncia i 33CV375C31 JUDGMENT Is ENTERED As FOLLows av: ms count D ms CLERK 3 Parties. Judemem :s a. (""73 tor alaimm (name each): Mohammad Mustata and ogdul defencam {mum cam). Christine Piacencia ___ ’ I Comma! onAnachmentaa (form MC-CZS) t: ‘ 1m Widen: (name eam)‘ 4‘ [E Plantar L; Detenmm vs enmlau to messaon o! the morass mated a1 {street amass. apartment. :ay. andmm: 3652 Slapcvicw 3n. San Jose, CA 95148 (Santa Clam County) 5 D Judgmen! appces to an occupanzs ol me premases mdznwg zenams. subtenarés i! any, and names cuiments i any (Coda Civ Proc, §§ ’15‘010 1‘69. and H743; 5. Mum: and terms at judgment a. A I Detendam named tn aw 33 above must pay mama on me o CZ] Hanna -.s to recewe nolnmg vmm camam comptaint: named in Elem 3b m D pulrduewm 5 I C goeggwgmramednmmamsmrecmr (2) 3:] Hmooveraamges s 31.065.89E Draw aflmnevfm S (3) C3 AnomeySees S 1 (4) E Coats S 695- iOO <5) S mneuspocm. s o (s) romuuncuem s 31,?I0~§9 c. l 1 The tents: agwenwm iscanceiec. E The Iaaze v5 ’onejev; 7- I m1 Conofl'nnal iudgnam. Pia’ntm has breached me ugrecmcm to ptozide Webb ptemises to dctcrdam as slated :nAW(Mama 091m Amormm (lorm ‘JD-u 10$). whach u, attached. ‘ 6. E Other (swam): ;____l Cominuedon Ammeme (mm M6025. p", Date: - LL?“3‘433’ 9 JWmlOvcrton W“: C7 “it?! _. M _m_‘,”.;,_°3?_¥z‘ mu. CLERK'S CERTIHCATE (Ophonal) :cenfy um th's is a true copy o1 ere m'na hymen! 3n hie m me court. Date C‘mk. by . Dewy ‘ ”°"““"‘“" ‘m JUDGflEN‘P-UNLAWFUL DETMNER ”0"“: LemYnmv Aram Ch‘alonw Juniaa! (Tatum! Form I‘J ’oJ 'JI Santa Cruz. CA 95062. lam over the age of ei teen ( 18) years and am not a party to the muse for Which I am serving the document(s) described clow. on the parties below by placing a true copy thereof in a sealed envelope and serving the same as follxm‘s: V: was executed on September 10. 202 I , 2n Santa Cruz. California, OPPOSITION TO EX PARTE APPLICATION FOR ORDER SHORTENING TIME FOR NOTICE OF MOTION L899! OF SERVICE The undersigned declares as follows: I am a resident Montcrcy County. California. My business address is 1726 Scabright Ava, On September IO. 2021. I scrvcd the within: OPPOSITION TO EX PARTE APPLICATION FORORDER SHORTENING TIME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION BY MAIL. [caused such envelope Io be deposited. with postage prepaid. in the mail at 52mm sz, California. I am readily familiar with the practices of the STONE - SIEGEL LAW FIRM for collecu'on and processing of con’fipondcnce for mailing with the United Stams Postal Service. In the ordinary course of business. correspondence would be deposited with the United States Postal Service on this day CTCPflQQLa). BY PERSONAL SERVICE: lcauscd a copy ofsaid documcnm to be hand delivered to the interested panics at the address set forth below, _C_'C_'E_§LQLL . Superior Court ofCalifornia County of Santa Clara 19] N. First St. San Jose. CA 951 1.3 EMAIL OR ELECTRONIC TRANSMISSION: Name: Email: I declare undcr penalty ofperjury that the foregoing is true and correct and that lhls declaration /s/ Leo B.fSicgcl ’ 9 FOR NEW TRIAL AND FOR STAY OF W'RIT OF POSSESSION p: OwQOMAl-DN MNNNI-‘v-Hu-os-h-a-wp-H Leo B. Sicgcl, SMeM No. 116841 l D STONE- SIBGELLAW FIRM SEP 1 0 2021 1726 Smbdgt Ave. Santa Cruz, CA 95062 (gs [)768'q U 0 Ciel’k Of mc'gwcoggm leob@legalsicgel.org e Attorney for Plainfiff, MOHAMMAD MUSTAFA RYAN NGUYEN SUPERIOR COURT OF CALIFORNIA COUNTY OF SANTA CLARA H MOHAMMAD MUSTAFA CASE NO. 21CV375631 Plaintifi, Date: September 10, 2021 Time: 9:00 aJn. vs. Dept: 11 Judge: Hon. Carol Overton CHRISTINE PLACB‘ICIA; and DOES 1-6, indnsivc. OPPOSITION DECLARATION AND MEMORANDUM OF FONTS AND Defendants. AUTHORITIES IN OPPOSITION TO Bi I PARTEAPPLICATION MOTIONFORORDER SHORTENING TIME FOR NOTICE 0F MOTION FORNEW TRIALAND FOR STAY OF WRIT OF POSSESSION Date Action Filed: January 25, 2021 Trial Date: Post Tn'a] Mofion I, Leo B. Sicgcl, declare l. I am an attorney a law, licensed m pracficc in the State ofCaIifornia, and am the attorney of record for the Plaintiff in mis acn'on. I have personal knowledge of the facm set forth in tfis dedamn'on, and could tan‘fy competentlym them if mlled as a witness to do so. 2. This is an unlawful detainer action- Plainfiff acguimd u'tle to the subjca Property fiom Defendant’s lender, afier the lender had foreclosed under the power ofsalc set form in a deed ofuust itheld aginst ml: to the Property, which instrument secured a loan it had made to the Defendant. 1 OPPosmON r0Ex PARIEArmcmozv Pox ORDER snoummxommFannonca ox: monox FORNEW TRIALAND FOR STAY 0F WRITOFPmSESIw WMQO‘Mhu-‘NH N NM NN-a-«v-Iu-u-u-u-p-r-I- After having served Defendant with the requisite 3-Day Notice ofTermination of Tenancy (after foreclosure), and 3 days then having passed, Hainfifl‘s complaint for Unlawful Defiant was filed on Jammy 25, 2021. 'flmt is almost 8 months ago. Furthermore, going back to the dme me bank stamd its foreclosure proceeding to remove Defendant fiom fide to the subject Property, she has withhdd possession from its n'ghtful owners FOR OVER TWO YEARS. Afier 8 months of numerous dilatoxy motions filed in this Court, the case was set for a court trial on Scptember3, 2021 before the Hon Carol Ovcmn, in Department ll ofme Count. 3. Onthe day f0: m'al, thn Court waited mu"! 9:30 am. forDcfmdant to appearwhen the case was called. Howard, Defendant made no appearance either in pason, or by electronic means. The Court then spcdfimlly nomd on the record that the Clerk ofthc Courthad duly nofified Defendant ofthe Trial date and fime with a Notice ofScheduled Unlawful Definer Txial Date thatwa mailed to me address of record for the Defmdant. Thc Notice was entered in evidence as Exhibit l. §g_e, Exhibit “A"Med to this oppodfion brief. 4. Defendant appears to have consulted with attorney Kennem Carlson, fi'om Idylwild, Califomia, who isknownm operate abusinms named CaliforniaTenant Law, andwho adverfisa on the interact as being able to assisttcnanm in thwarting their landlord‘s effortsm evictthemm pro per defmdams. MI. Carlson's website may be found at altcnantluwcom He advertisa a plcthom of legl hm and services that are sold to tenants and whicl} arc dsigncd to delay the proms of rcmovingtcnams from possession ofa landlord‘s real property, and claims that the courts and 1'11ng regularly violate the law in cfl‘orts to coopaatc with landlords evicfing theirtmnts. Daphe the fad Defendant PLACEVCIA is appcazing in propxia persona in this acfion, atmmey Carlson’s oficc is providing her guidance throw his interact ptogams, as he is me Individual Who has signed Proofs of Service for Defendant's pleadings thxoufiout dis acfion. In addiu'on, on numerous occaions during this action, Defendant's counsel has been conmcmd on the phone and byemail byone oer. Carlson” s associams, who nou'fied Plainfiffofthc Defendant‘ s intent to appearon thc court‘s ex part: calendar for various mou'oas she has filed in this action, all succssfully delaying herbdngmoved from possssion of Plainn'fi‘s Property. ///l/ 2 OPMIHON TOEX PARI‘E APPUCAI'ION FORmm51-10anmFORNOTKEWMOTION MNEWI‘RIALAND FOR STAYOFWRITOFMSESSW WOOQO‘MAUJth-o Q MN MNNH Ht-d h-ou-n r-o pt papa pa 5. By way ofbackgound, Plainfifi submim thc following fimc line in mis acn'on: 12/30/2019: 12/30/2020: 01/08/2021: 01/25/2021: 02109/2021: 03/100021: 03/24/2021 : 04/0 1/2021: 04/02/2021: 04/02/2021: 04/05/2021: 04/08/2021: 041142021: 04/21/2021: 04/22/2021: A Trustee‘s DeedUpon Sale was recorded as DocumentNo. 24368498 in the Official Records ofSam Clam County, which relieved Defendant offiflc to the sub‘ real gropcrty located at 3652 Slopcvicw D11, San Jose, CA 95148 (hacina r ‘1he ropcm' ’); Plainfiff, MUSTAFA acquircd fitlc to the Property from the foreclosing lender with -a Grant Deed recorded as DocumentNo. 24769045 in the Offidal Records of Santa data County. It is notable mat Defendant had by film likely been IiVing both rent- frec and mortggc-fiee in the Property, Defendant was saved with the 3-Day Nou‘cc to Quit pursuant to Code of Civil Procedure § 11613, which notice formed me unddying basis for this Unlawful Dctainer acn'On; Unlawful Detainer Complaint was filed; 0n or about 2/9/21 , Defendant filed a Mofion to Quash Savicc of Summons, based only on the gound that she had notby that date been saved with the Summons and Compldnt in this acfion; Plainfiffs Opposition to the Quashal motion was filed, attachingcopia of 2 separate Proofs of Service ofthc Summons and Complaint served on the Defendant, After having continued the hazing on the Defendant's Motion to Quash, the Court in Department l2 (Hon. Nahal Imvani-Sani) heard and denied the motion, ordering Defendant to filc an Answa to the Complaint wimin S days. 'Ihc Court furflmr ordered me panics to return to Department 12 on April l4, 2021, at 9:00 am. for a Case Sums Review Heating; Node: of Entry of Order Denying Defendant's Motion to Quashwm filed; Defendant filed a docuqut entitled “Node: of Piling and Antomafic Prevention of Default,“ without, as requucd, having served it on the Plamuff, Some time between April 2, 2021 and April 8, 2021, Defendant filed, but did not serve on the Plainu‘fi, a Petin'on for Writ of Mandate and Temporary Say of Tzial Conn Proceeding; Court Qeck initially entered Defendant‘s default The Court'sAppdlaIe Division denied the Dcfcndam‘ s Pcdu'on for Writ ofMandatc, indimfing that along with her pct'm'on, the Defendant was not prevented fiom filing a response to the Complamt The Court reviewed the sums of this case in 1i t ofthe Appellate Court’s rcjccu'on ofDefcndam' s Pcu'u'on forWrit ofMandatcan Smyoan'al CourtProcwding. The Court ordctcd that Plainfiff should resubmit a chusst for Enuy 0f Default and Default Judgncnt‘, Pursuant to fl1e Court‘s Order, a new Regucst form of Default and Defwgt Judmcnt wa'c filed and enmrcd; Judgnent for Posscssion of the Property 'm favor of Plaintiffwas entered; 3 OPPOSITIONTOR PARIE APPIJCAI'IW FORmm SHORIENDIG1M FORNOTICEWMOTIW FORNBW RIAL ANDFOR STAY 0F WRIT 0P ?%SESSION OOOQGUIAWNH- N IQ N N N N N r- h- .- H ha 0-- r-I t-d p-t t-n 04/23/2021; 05/10/2021: 05/1 3/202 l : 07/08/202 1: 09/03Q02 l : Defendant filed a Mofion for Relieffrom Default, intmding to file a Dcmun’cr to m: Plainfist Complaint for Unlawful Dcta'mcr. At the imtial hean’ng on that mofion, Defendant lodged a Pcremptory Challenge to me mmm- bcing heard by a Commissioner, whereupon, it was continued to May 10, 2021, before the Hon. Cynthia C. Ii, in DQamnent 12. Defendant‘s Motion forRelieffi'om Defaultwas gamed whenhdgc Li found that the Court Clerk‘s confimion lad to Defendant's Dunner not being timely filed; thc Court's order granted Defendant rcliefto file an Answer or a Demurrcrwithin 5 days. Defendant filed a Danurrer to the Phinfifi’s Complaint. It was set for hcaxing inifiallyon June 16, 202 1 , in Department 4, bcfomCommissionerJohnson. However, the Court continued the hcaringmasponle, to July 8, 2021 in Deganmcnt 12, bcfoxe the Hon. Nahal Irvanj-Sani, when it was determined that Dcfen ant had previously challcnged Commissioner Johnson. Judge Iwani-Sani overruled Defendants‘ demurrcrs tomeComplaint, and ordcred tint anAnswerto the Complaint be filed within 5 days. The chk's 0mm: foxwarded the filcd Order to Plaintiffs counsel on Angst 5, 2021. Although Defendant never bothered to serve Plainfiffwith a copy of her Answer to the Complaint, the Court Clerk eventually advised Plaintifl‘s counsel that an Answer wm indeed filed on thc last date the Court provided forher to do so. A Request to Set Case for Trial was then filed, and the trial was scheduled for Semanber 3, 202] in Department ll, before the Hon. Carol Ovcnon. Defendant failed to appw at tdal by 9:30 am, despite havingbeen duly served wim the Clerk's Nofice ofScheduled Unlawful Deminer Trial Date, whichwas mailed to hcratthe addmss she filed with the court. SeeExlu'bit "A. " Judgment for possssion, W$ entered in Plainfifi s favor, with an award of holdovcr damagm and costs of suit in the sum of $31,? 10.89. See. Exhibit "B. " I declare under penalty of perjury that the foregoing is true and correct, and mat this dedamion was executed on September 9, 2021, at Santa Cruz, California n Leo B. Sic MEMORANDUM 0F POINTS AND AUTHORITIES 1N OPPOSITION To Ex PARTE APPLICATION MOTION FOR ORDER SHORTENING 11MB FOR NOTICE 0F MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION ARGUMENT I. IN LIGHTOFTHE FACT THE TRIAL COURT ENTERED A FINDING 0N THE RECORDATTRIALONSEPTEMBER 3, 202 l, THATDEFENDANTHADBEEN DULY SERVED BY MAIL TO HER ADDRESS OF RECORD AT THE COURT WITH THE CLERK'S NOTICE OF SCHEDULED UNLAWFUL TRIAL DATE, 4 OPPOSITION T0EX PARIB APPLICAI'IW FORmm SHGUEJING1MFmNOTICE OFMOTIW FmNEW TRIAL ANDFOR STAY OF WRIT OF POSSESSIW WmflmmkWNH M wwr-v-av-va-‘u-nn-a ngcmflaquN-‘O 24 25 Z6 27 28 SHE CAN NOT SATISFY THE CODE 0F CIVIL PROCEDURE § 473(1)) REQUIREMENTS FOR RELEF FROM DEFAULT OF A SHOWING OF “MISTAKE, INADVERTENCE, SURPRISE OR EXCUSABLE NEGLECT." In yet a further effort to oonfinue withholding possusion of the subject property fi‘om its rightful owner, Defendant now sacks to move thn court for a ncw trial and a say ofPlainfifi‘s Writ of Possession that was issued on Scptcmbu' 7, 2021. Hainfiff is unaware of the grounds for this applicau'on, for as is her usual pmou'cc, Defendant has failed to save Plainfiff with a copy of her plmding in supporu'ngit. Assuming, howcva, thatitis based on Code owail Proccdure § 473(1)), claiming mather failure to appear at nail was throng “mistake, inadvertencc, surprise, or excusable ncgcct,“ this applicafion and anymy of Plainfifl‘s Wxit of Posswsion, should be denied. Inmmnchas itcan notbe qncsn‘oned thatthc Clad: ofthe Court served Defendantwifi proper non'ce of file u-ial in mis acu'on, which was mailed to the address Defendant provided to the Court, with no notice ever having been filed chang'ng her address, this is simply a matter where the Court should find that“ENOUGH IS ENOUGH." Defendant has now livemoxtgge and rent free fox over two (2) ym- That delay in thebank and me Plainfiffin this acu‘on recovering possession of their property is not even atm‘bumble to any Covid-19 delays. It arism cnfircly out of the Defendant's numerous, nnsupportable mou'ons, and last-mimm: challenge, all ofwhich have been denied, that have mused delay aftu' delay inbring’ng this action to uial. Thenwhen she fiiled to appmr at filial, it seems Defendant will now claim that her failure to appear was through some unknown mismkc, inadvertenoe, surprise or excusable neglect, thereby seeking yet a fmfixcr delay ofperhaps monms before this case ever $15 to a final rmlufion. II. wmnmwmmfirmm HI;33an SHOULD BE BACH‘IANDED,AND THIS APPLICATION DENIED, BECAUSE PLAINTIFF HAD RECEIVED No NOTICE 0F ANY CHALLENGE HAVING BEEN NOTICED, 0R GRANTED. Plasmirris advised um while Dcfcndam failed to appw at trial on September 3, 2021, she objects to the Hon. Carol Overton havinghard the uial, on the ground thatjudgc Ovcmnhad been preempted under Code of Civil Procedure § 170.6. Any such argument submitted in support of a motion for a stay of execution of Plaintiff‘s Writ ofPossession and in support ofa mofion for anew 5 OPPOSITION TomtmammumnonFORonnm snoamNmG 11MBEonNOTICE 0F MOTION MNEW TRIALAND FOR STAY 0F WRITOF POSSESSIW _._..V..--..7»~__#_ . . ___.__V,_ 7.. 4_-._#.77. V~~___._ 7....-- ,.. i’mwb-A \DNQOM&UJNr-n p...O uial should be denied. Phinfifinwu received notice ofanyperemptorychallengem JudgeOvuton's jurisdicu'on ova the ease and the panim. The only challenge Defmdant is known to have made was ofCommissioner Johnson hearinganymattcm in the case, and consequcmiy, he did not preside over the trial proceedings. Therefore, should Plaintifi‘ assert a peremptory challenge in support of ha present cx pan: applimfion, it should be iporcd and this application denied. CONCLUSION Band upon the foregoing point and authoxities and the argument included herds, Plaintifi‘ urgfi the Court to deny Defendant‘s Ex Part: Applimtion to Smy the Wu”: of Possasion issued in this use on September 7, 2021, and any order ammor'm'ng the filing of a mou‘on for a new trial. Dated: September 9, 2021 Rapectfully submitted, STONE-SIEGEL LAW‘FIRM Leo B. Sieg , Attomcy for Plam Q OPPND'ION TOm PARTS APPHCATIONFORmaMININGMFORNOTICE OFMOTIW FORNEW TRIAL AND FOR STAYOF WRITOFPWSBSION '4‘ ~v--~ ~‘--~-~ Vr- ~ «WV h ~ #g 7‘7 v" .- OWQGMAUJN Nv-‘r-v-Hh-nv-It-ar-ob‘v- OWmQQMbWNr-‘O NNNNNMNN mqomwaw EXHIBIT A 7 OPPosrnON ToE: PARTSAPPLICATION FORmmsumo TIMEFORNOTICEmmonm MNEWI‘RIALANDFORSTAY OF WRITOFPOSSBSSION SUPERIOR COURT 0F CALIFORNIA COUNTY 0F SANTA CLARA DOWNTOWN COURTHOUSE 191 Noam F13575mm SANjosE. CAL'Fomzu 95113 CMLDW’LSION Leo B Siegel Stone ' Siege! Law Firm 1726 Seabright Ava Santa Cruz CA 95062 RE' Mohammad Mustda vs Christine Placencia Case Number. 21cvs75331 NOTICE OF SCHEDULED WLAWFUL DETAINER TRIAL DATE The above entitled case has beer. set for trial in this Cou't. and you are direcwd to appear. Dale: September 03. 2021 Time: 9:00 AM Dept: Department 11 No farmer notice win be given by the Com. Note the following: If pu have received notice that an appticat'on for waiver of court fees has been denied. failure to pay fees in a timely manner may result in the coun Ira being vacaled without further notice and theW may proceed with defautt and default )udgment. For fumer information, 0mm the Catendar Office at (408) 882-21 00. Ifyeu.apanyrepvesentadhyyw.aastsbbeauedmbenldmmneedammafimmmm u’lhDim” Ad. plenum meCounWhat! 0&5: a: (‘06) 882-270). onsehe Wis TOOIne. (408)882-2690 ormevo‘chDDCaficniaRelay Sewice.(800) 735~2922. DECLARAnouorsaavtcesYuNL: Iuedueunéamdmmtlwmmtymodngammma sealed mva'ope.addressedtaeadme:sonwhose nameisslmw.am,wwmmmwmm preoa'd.hmeu.s.Ma‘lat$anJose.CAonAuot5227.2021. CLEMOFTHECOURT.bySazua\/ua.bspny. cc: Chr'wu'ne Placemfia 3277 S While Ru #272 San Jose CA 95148 CV-5073 REV0136/16 ’- ~.__. ! CASE Mo; fl wb'lséfit EXHLL ,l Identification D Admitted a Mimarfiz vs. Vlméq DATE: ’ ?’3’21 CLERK: J. Mom‘ss WmdofimémN- lo N N r- v-a u-o r-a 7- r-n r-a H w v_- NMmfl EXHIBIT “B” L OPPMITION TOE!FAREAPPLICATIONFOR. ORDER SHORIWWG TIMEFOR NOTICEWMOTIW FORNEW TRIAL AND FOR STAYOF WRITOFmam T un-nom W. M mmww “111m B sfm, Esq.‘ (Smflfi'h‘r?fiéwf PSTON'E IEGEL LAW FIRM 3723363“ Aavsfiszan gnawmmmf) 753.91m mmman) 713-5797 isums wawleob@lc alsi ' mmmgmplainuffFMOfiMMAD MUSTAFA l .- E mmmmmmn,cmosSAbn'A CLARA SEP o 3 2wmm 191 N. First St. MLMWWIN. FirstSL cunnarcwesan Jose 951 l3 mums: WFP- MOHAMMAD MUSTAFA DEFENDANT: CHRISI'INE PLACENCIA JUDGMENT-UNLAWFUL DEI'NNERD Eyck!“ E33m Emmrrwmmm BMW Emma. 21mm! Append?!“ .mnsusm 1. C3 avoemuu n. Wwwmflhamamammmm b. Detmdmtfafledlnanswerhecomrurappeamddebndkeefionwi’flahhaalomdbth. c. Delmdanfsdefwiwasenmwwmwkupmphmnpptmlbn. d.D Cletk’s Judgmm (Cade Civ. Pm. § 1169). Fa postessbnmkdmwmmm2fm 4). e. [E mwdmnucmav.m.§sas(b».WNWmm pimsmmnyamawmm (22E: wmvsummmmmmwdamwom m.fioc..§585(un 2. [fl AFTER coum'mw. Themwasmnm memunwnsoemmem. a. Thoma watrledm {dueandi'mekSeplcmbu’ 3. 2021 won (name«Wand: Hon. Carol Ovmon 'n.AW by:m Plain?! {me each): m W3ammov(MM Mohammad Mumfa m Leo B. Siege! (2) Dcm onma: awn“om Enema“(mm; aWsmtmm Christine Piacencia U) (21 memmamm. c m Defendantddnotwpeammal. Defamawaspmpndysmdwwwam d. m Amlamanofdudfionmodamvmmcqsm) m wasnot [j was talcum hp‘d::Wcraw- Juocum-umwrm 02mm: wmwm‘m mmmJa-uyhm MJWIWWMFHN u, WzMommmad Mustafa cam omnmrfihfisfine Placem‘ja 210375631 wncmtssmmannsmousav: @mcoum DmECLERK 3. Parties. Wen! Is a. E] tormam:(am each): Mohammad Mustafaw aga'usl defendant (name anal): Chrisfim PlacenciaD cmwunAaad-nmaa (cammm b. [jarm (name each).- 4. m Haw: [j Datamam smmwosessbnommmmmu mmmmmmuy. mam): 3652 Slopcview Dr., San Jose. CA 95148 (Santa Clam County) s D Wmmammotmepmiseswmtemsmxmnm.mnmmzslanywouaav. Pmc.. §§ 715.010. 1109. and 11743). fl Wandmmsotjudgmem a. D DmmmkemaaabmmstpayphMonm n.Dmsmmmmmmm mums; (1) [j Paaw-mem s Dmmmmmbwm ‘2’ m Hokioverdnma s. 31,065.89 mmmm‘s (3) D Attomeyiees s (4) m Costs s ."eVS. oo ‘5) D awrspodyr s (6) Tornwoam'r s 351.10. t7 c.D Themlalagtesrrml'sameld. DTheleueislodolod. 7-D commonauudgnm nwnmmawmegmmmmwmeumwquasmm Wem-UnWDauiaAmmaom U0-1105).utid1isanached .. B.D 09:0!(M): C] cmimedonmwa amuooes}. flDaze: [g ' I'?’3’0103" V JWIOvedon Data: C] Clemby .Domdv m ‘ CLERK'S CERTIFICATE (Ophnao lwflymmkatmmolmodgMimemhhhewm Dana: clumsy .080"? - wwwmmm Juoemem-uuuwrm.oaum mam ' WWWWWCW Fora: WW-JOKUIAWN-n NNNNNHHHh-ur-n-Ip-wu PROOF 0F SERVICE The undersigned dcdares as follows: I am a msident Monterey County, Califomia, My husinss address is 1726 Seabright Ave., Sana Cruz, CA 95062. lam over the age of eigteen (18)yam and am not a party to the muse for which I am servingme document(s) described elow. On September 10, 2021, I sewed the within: OPPOSITIONTOEXPARTEAPPLICATIONFORORDERSHORTENNGTIME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION ?nnthc pam‘es below by placing a true copy mereof in a sealed envelope and serving the same as o ows: BY MAIL: I caused such enveIOpc to be deposited, with postage prepaid, in the mail a San Cruz, California. I am readily familiar with the pmctica of the STONE - SIEGEL LAW FIRM for collccn'on and processing of correspondence for mailing with the United Smtes Postal Service. In the ordinary course ofbus’mms, correspondence would bc deposited with the United States Postal Service on this day. CCP §1013ga). BY PERSONAL SERVICE: Icauscd a copy of said documents to bc hand ddivcrcd to the intacstcd pam‘s at the address set forth below. CCP §lOl l. Supcxior Court of California County of Santa Clara 191 N. Fast St. San Jose, CA 951 13 7X EMAILOR ELECTRONIC TRANSMISSION: Name: CHRISTINE FMFXCM Email: c,CanJy5 e 1akm.m Ideclareunder pmaltyofperjurythatthe forcgwingis true and correctanddmfir. dedmfion was executed on Septanbcr 10, 2021, a! Santa Cruz, California. fi B. Siege] g: 9 OPPmfl'lON TO BK PARTB APPLICATIWFOR ORDER SHORTWING1M FORNona OFMOTION FmNEW TRIALAND FOR STAY OF WRIT OFMWION NAME OF COURT: SANTA CLARA COUNTY SUPERIOR COURT STREET ADDRESS: 191 NORTH FIRST STREET CrI'Y, STATE, AND ZIP CODE: SAN JOSE, CALIFORNIA 951 13 PHONE NUMBER: (403) 832-2 1 00 . F I L ED PLAINTIFF; MUSTAFA MOHAMED olflll SE? ‘13 P |= 0Q DEFENDANT: CHRISTINE pLACENCIA Civil Case» STAY 0F EVICTION Shenfidxvnl Q (£953% Application for a Stay of Eviction by Defendant/Applicant: 1. Total Days Requested: l4 DAYS 2. Daily Rental Value $133.33 / DAY = 3. Amount to Deposit 1 866.62. Name: CHRISTINE PLACENCIA Address: 3277 WHITE ROAD #272 SAN JOSE, CA 95148 Telephone: E Stay of Eviction is ordered granted on the following condition: o Upon payment of $1 866.62, in cash or certified funds, pay to the Clerk’s Office at the above address on or before 09/13/2021, by 1:30 P.M. o Stay is ordered granted until 09/1 7/2021 (# l4 days from 09/03/2021 date of Judgment.) Funds to be disbursed to the plaintimplaintifl’s attorney afier Stay date. (Note: The Court policy is to hold ‘certified funds’ for 30 days before disbursement) o Other: Above payn_Lent to tthlerk’s Office and their notification to the Sheriff's Ofice of the receipt thereof must occur BEFORE tlie lock-out. Ifthe lock-out haillready occurred. this Order is null and void. D Stay of Eviction is ordered denied. 0 @iDate: 09/13/2021 (x _ HON. CAROL OVERTON JUDGE OF THE SUPERIOR COURT Special Instructions by the Court:_ Applicant is to return to the courtroom with their receipt fonhwith for further instructions on the Stay of Eviction. X No further action is required by this applicant. By Courtroom Clerk: Kathy Davim, CRC CLERKS OFFICE E ONLY D CASH Certified funds s [1H, 3,2 RECEIVED 0N 09/13/11 (DATE)., ,SHERIFF NOTIFIED BY FAX (CLERK' s INITIALS) (Note: ATTACH COPY 0F FAX TRANSMITTAL REPORT TO ST Y FORM. ) STAY OF EVICTION \OOOVOUIAUJNH NNNNNNNN----~-p-nu--d gNOLflk‘IJN-‘OOWQQU‘kWN-‘O Leo B. Siegel, State Bar N0. 116841 STONE - SIEGEL LAW FIRM 1726 Seabright Ave. Santa Cruz, CA 95062 831/71 3-5773 Telephone 831/713-5797 Facsimile leob@legalsiegel.org BY Attomey for Plaintiff, MOHAMMAD MUSTAFA SUPERIOR COURT OF CALIFORNIA COUNTY OF SANTA CLARA MOHAMMAD MUSTAFA CASE NO. 2 1CV375631 Plaintifi‘, Date: September 10, 2021 Time: 9:00 a.m. vs. Dept.: 11 Judge: Hon. Carol Overton CHRISTINE PLACENCIA; and DOES 1-6, inclusive. ORDER DENYING EX PARTE APPLICATION FOR ORDER SHORIENING TIME FOR Defendants. NOTICE OF MOTION FORNEW TRIAL AND / FOR STAY OF WRIT OF POSSESSION Date Action Filed: January 25, 2021 Trial Date: Post Trial Motion Defendant, CHRISTINE PLACENCIA’s Ex Pane Application for a Stay of Execution of Judgment and for an Order Shortening Time for Service of a Motion for New Trial came on for hearing before the Coun 0n September 10, 2021, in Department l 1, before the Hon. Carol Overton. The Court continued the hearing to 9:00 a.m. on Monday, September 13, 202 1. On Monday, September 1 3, 202 l , the Motion came on for hearing again before the Hon. Carol Overton, in Department ll of the Court. Leo B. Siege! appeared by telephone on behalf of the Plaintiff,MOHAMMAD MUSTAFA, and Defendant CHRISTINE PLACENCIAappwed in propria persona. The Court then again continued this matter to Thursday, September l6, 2021, and issued Defendant a Stay of Execution until Friday, September 17, 2021, conditioned upon Defendant l ORDER DENYING EX PARTE APPLICATION FOR ORDER SHORTEN[NG TIME FOR NOTICE OF MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION \Omflamfith-u QNNNNNNH-IF-u-w‘fl-a-nflg ?og'osmAwN-ooooqoxmghwm-uo PLACENCIA posting the daily fair market rental value of the Property with the Clerk of the Court at the rate of $1 33.33 per day. for the total of l4 days from the date of the Judgment entered in this case on September 3, 2021. in the total sum of $1,866.62. Plaintiff having timely posted the aforesaid total sum with the Clerk of the Court, and the Court having considered the pleadings submitted in support ofand in opposition to the Application and having heard the oral argument 0f the parties at the hearing on Thursday, September l6 2021, finds that Defenth has demensimted PNIC‘de :OmLthf, figmesfl's 0f A424- Mo-f Ion fliedAl-i {ads €S+G~b l: s‘ Anj7 WLLLsuHeI-eMrhmdslfip‘irrtFe-ime‘ofimm T’A{ 000,-? Ao+t$ 445-," +L\C- . dgmcm 4.x 4; v c 7‘”: Jun 0"SAOA+cn‘fl? +IM1 4&3 hpoq/‘hin ”’0’: ‘~ 1 frpMJ'«c f M?Uv 'l afi‘raed . {’U rm f' ‘14 T ‘- = . n EB. It is further ordered that Plaintiffmay . instruct the Sheriffof Santa Clara County to I o - I complete execution ofthe Judgment entered in this case on‘ 2021 pursuant to the Writ of Possession issued on September 7, 2021. S Ac q l é 0 a J" 1 a “‘4! A&Zef *o ’ny¢~r+ P¢$°"‘¢¢ MQALfc‘Ay PRIMC‘fI o +Ar‘94’ Dated:September 16,2021 p er o é o fi ?~ ’f’ 1° 1’ I J 9- 30 ' L ° L ' t (2 LC. P la. a 4" #4,“. y Judge 0T1he Superior Court Mm lmrrmor 7H; PAMPI o; yam. 21cm; CNArJ 4a cOJWfo/tr-I'c cxtcdf-ch“ o ,C' flve JQ47M¢¢+ Format“ afie +1“; ?»>~zozr CJDA-I’ FDKTH LQITH. 2 ORDER DENYING EX PARTE APPLICATION FOR ORDER SHORTENING TIME FOR NOTICE 0F MOTION FOR NEW TRIAL AND FOR STAY OF WRIT OF POSSESSION Now THEREFORE, the Coun hereby or ers as fofiows. R:5,3 J “‘5“ £133 t ' “c1" dev- Lc-Lf'J‘ 0-1 +L£ Mt“ I I’j ‘L f fkk 9/10/2u Aewi x PROOF OF SERVICE BY MAIL STATE OF CALIFORNIA, COUNTY OF RIVERSIDE [am employed in the County of Riverside, California at PO Box 241 7, Idyllwild, CA 92549. I am over the age of 18 and not a party to the within action. On 09/17/2021 , I served the Petition for Wn't ofMandate, with a Notice of Stay on the opposing party(s) in this action by placing a true copy thereof enclosed in a sealed envelope with postage thereon fiJlly prepaid in the United States mail at Idyllwild, California, addressed to: Leo Siege] 1726 Seabright Ave Santa Cruz, CA. 95062 Hon. Carol Overton 191 North First Skeet San Jose, CA 951 l3 I declare under penalty of perjury under the laws 0fthe State of California that the above is true and correct. Executed on 09/17/2021 at Idyllwild, California l L Eg SEP 20 2021Ken Carlsfn awfigc'erk of the Court BY cu" 0' CA CW 0' Santa Clara